COPE (NM_007263) Human Mass Spec Standard

SKU
PH303531
COPE MS Standard C13 and N15-labeled recombinant protein (NP_009194)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203531]
Predicted MW 34.5 kDa
Protein Sequence
Protein Sequence
>RC203531 protein sequence
Red=Cloning site Green=Tags(s)

MAPPAPGPASGGSGEVDELFDVKNAFYIGSYQQCINEAQRVKLSSPERDVERDVFLYRAYLAQRKFGVVL
DEIKPSSAPELQAVRMFADYLAHESRRDSIVAELDREMSRSVDVTNTTFLLMAASIYLHDQNPDAALRAL
HQGDSLECTAMTVQILLKLDRLDLARKELKRMQDLDEDATLTQLATAWVSLATGGEKLQDAYYIFQEMAD
KCSPTLLLLNGQAACHMAQGRWEAAEGLLQEALDKDSGYPETLVNLIVLSQHLGKPPEVTNRYLSQLKDA
HRSHPFIKEYQAKENDFDRLVLQYAPSA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_009194
RefSeq Size 1134
RefSeq ORF 924
Synonyms epsilon-COP
Locus ID 11316
UniProt ID O14579
Cytogenetics 19p13.11
Summary The product of this gene is an epsilon subunit of coatomer protein complex. Coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles. It is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. Coatomer complex consists of at least the alpha, beta, beta', gamma, delta, epsilon and zeta subunits. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:COPE (NM_007263) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC404568 COPE HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC416083 COPE HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY404568 Transient overexpression lysate of coatomer protein complex, subunit epsilon (COPE), transcript variant 3 100 ug
$436.00
LY416083 Transient overexpression lysate of coatomer protein complex, subunit epsilon (COPE), transcript variant 1 100 ug
$436.00
TP303531 Recombinant protein of human coatomer protein complex, subunit epsilon (COPE), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.