OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

COPE (NM_007263) Human Mass Spec Standard

Be the first to review this product
SKU
PH303531
COPE MS Standard C13 and N15-labeled recombinant protein (NP_009194)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA324398 COPE Antibody (C-term)
400 ul
$645.00
LY416083 Transient overexpression lysate of coatomer protein complex, subunit epsilon (COPE), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "COPE or NM_007263"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203531
Predicted MW 34.5 kDa
Protein Sequence
Protein Sequence
>RC203531 protein sequence
Red=Cloning site Green=Tags(s)

MAPPAPGPASGGSGEVDELFDVKNAFYIGSYQQCINEAQRVKLSSPERDVERDVFLYRAYLAQRKFGVVL
DEIKPSSAPELQAVRMFADYLAHESRRDSIVAELDREMSRSVDVTNTTFLLMAASIYLHDQNPDAALRAL
HQGDSLECTAMTVQILLKLDRLDLARKELKRMQDLDEDATLTQLATAWVSLATGGEKLQDAYYIFQEMAD
KCSPTLLLLNGQAACHMAQGRWEAAEGLLQEALDKDSGYPETLVNLIVLSQHLGKPPEVTNRYLSQLKDA
HRSHPFIKEYQAKENDFDRLVLQYAPSA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_009194
RefSeq Size 1134
RefSeq ORF 924
Synonyms epsilon-COP
Locus ID 11316
UniProt ID O14579
Cytogenetics 19p13.11
Summary The product of this gene is an epsilon subunit of coatomer protein complex. Coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles. It is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. Coatomer complex consists of at least the alpha, beta, beta', gamma, delta, epsilon and zeta subunits. Alternatively spliced transcript variants encoding different isoforms have been identified. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "COPE" proteins (5)
SKU Description Size Price
LC404568 Lyophilized COPE HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC416083 Lyophilized COPE HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404568 Transient overexpression lysate of coatomer protein complex, subunit epsilon (COPE), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY416083 Transient overexpression lysate of coatomer protein complex, subunit epsilon (COPE), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP303531 Recombinant protein of human coatomer protein complex, subunit epsilon (COPE), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products