EIF3K (NM_013234) Human Mass Spec Standard

SKU
PH303529
EIF3K MS Standard C13 and N15-labeled recombinant protein (NP_037366)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203529]
Predicted MW 25.1 kDa
Protein Sequence
Protein Sequence
>RC203529 protein sequence
Red=Cloning site Green=Tags(s)

MAMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQIL
LKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRK
FICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFDSV
SSIMASSQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_037366
RefSeq Size 898
RefSeq ORF 654
Synonyms ARG134; EIF3-p28; EIF3S12; HSPC029; M9; MSTP001; PLAC-24; PLAC24; PRO1474; PTD001
Locus ID 27335
UniProt ID Q9UBQ5
Cytogenetics 19q13.2
Summary The 700-kD eukaryotic translation initiation factor-3 (eIF3) is the largest eIF and contains at least 12 subunits, including EIF2S12. eIF3 plays an essential role in translation by binding directly to the 40S ribosomal subunit and promoting formation of the 40S preinitiation complex (Mayeur et al., 2003 [PubMed 14519125]).[supplied by OMIM, Mar 2008]
Write Your Own Review
You're reviewing:EIF3K (NM_013234) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC415721 EIF3K HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415721 Transient overexpression lysate of eukaryotic translation initiation factor 3, subunit K (EIF3K) 100 ug
$436.00
TP303529 Recombinant protein of human eukaryotic translation initiation factor 3, subunit K (EIF3K), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.