ERp19 (TXNDC12) (NM_015913) Human Mass Spec Standard

SKU PH303511

TXNDC12 MS Standard C13 and N15-labeled recombinant protein (NP_056997)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC203511]
• Predicted MW: 19.2 kDa
• Protein Sequence:
  Protein Sequence

  >RC203511 protein sequence; Red=Cloning site Green=Tags(s); ; METRPRLGATCLLGFSFLLLVISSDGHNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACK; ALKPKFAESTEISELSHNFVMVNLEDEEEPKHEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYF; YVSAEQVVQGMKEAQERLTGDAFRKKHLEDEL; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_056997
• RefSeq Size: 2412
• RefSeq ORF: 516
• Synonyms: AG1; AGR1; ERP16; ERP18; ERP19; hAG-1; hTLP19; PDIA16; TLP19
• Locus ID: 51060
• UniProt ID: O95881
• Cytogenetics: 1p32.3
• Summary: This gene encodes a member of the thioredoxin superfamily. Members of this family are characterized by a conserved active motif called the thioredoxin fold that catalyzes disulfide bond formation and isomerization. This protein localizes to the endoplasmic reticulum and has a single atypical active motif. The encoded protein is mainly involved in catalyzing native disulfide bond formation and displays activity similar to protein-disulfide isomerases. This protein may play a role in defense against endoplasmic reticulum stress. Alternate splicing results in both coding and non-coding variants. [provided by RefSeq, Mar 2012]
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Glutathione metabolism