p38 (CRK) (NM_005206) Human Mass Spec Standard

SKU
PH303438
CRK MS Standard C13 and N15-labeled recombinant protein (NP_005197)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203438]
Predicted MW 22.9 kDa
Protein Sequence
Protein Sequence
>RC203438 protein sequence
Red=Cloning site Green=Tags(s)

MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHYIINSSGPRPP
VPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSRSRQGSGVILRQEEAEYVRAL
FDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYRPASASVSALIGGR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005197
RefSeq Size 3055
RefSeq ORF 612
Synonyms CRKII; p38
Locus ID 1398
UniProt ID P46108
Cytogenetics 17p13.3
Summary This gene encodes a member of an adapter protein family that binds to several tyrosine-phosphorylated proteins. The product of this gene has several SH2 and SH3 domains (src-homology domains) and is involved in several signaling pathways, recruiting cytoplasmic proteins in the vicinity of tyrosine kinase through SH2-phosphotyrosine interaction. The N-terminal SH2 domain of this protein functions as a positive regulator of transformation whereas the C-terminal SH3 domain functions as a negative regulator of transformation. Two alternative transcripts encoding different isoforms with distinct biological activity have been described. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Chemokine signaling pathway, Chronic myeloid leukemia, ErbB signaling pathway, Fc gamma R-mediated phagocytosis, Focal adhesion, Insulin signaling pathway, MAPK signaling pathway, Neurotrophin signaling pathway, Pathways in cancer, Regulation of actin cytoskeleton, Renal cell carcinoma
Write Your Own Review
You're reviewing:p38 (CRK) (NM_005206) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH301701 CRK MS Standard C13 and N15-labeled recombinant protein (NP_058431) 10 ug
$3,255.00
LC402580 CRK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC417443 CRK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402580 Transient overexpression lysate of v-crk sarcoma virus CT10 oncogene homolog (avian) (CRK), transcript variant II 100 ug
$436.00
LY417443 Transient overexpression lysate of v-crk sarcoma virus CT10 oncogene homolog (avian) (CRK), transcript variant I 100 ug
$436.00
TP301701 Recombinant protein of human v-crk sarcoma virus CT10 oncogene homolog (avian) (CRK), transcript variant II, 20 µg 20 ug
$737.00
TP303438 Recombinant protein of human v-crk sarcoma virus CT10 oncogene homolog (avian) (CRK), transcript variant I, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.