OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

BRMS1 (NM_015399) Human Mass Spec Standard

Be the first to review this product
SKU
PH303428
BRMS1 MS Standard C13 and N15-labeled recombinant protein (NP_056214)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA374086 BRMS1 Rabbit polyclonal Antibody
100 ul
$410.00
LY414569 Transient overexpression lysate of breast cancer metastasis suppressor 1 (BRMS1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "BRMS1 or NM_015399"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203428
Predicted MW 28.5 kDa
Protein Sequence
Protein Sequence
>RC203428 protein sequence
Red=Cloning site Green=Tags(s)

MPVQPPSKDTEEMEAEGDSAAEMNGEEEESEEERSGSQTESEEESSEMDDEDYERRRSECVSEMLDLEKQ
FSELKEKLFRERLSQLRLRLEEVGAERAPEYTEPLGGLQRSLKIRIQVAGIYKGFCLDVIRNKYECELQG
AKQHLESEKLLLYDTLQGELQERIQRLEEDRQSLDLSSEWWDDKLHARGSSRSWDSLPPSKRKKAPLVSG
PYIVYMLQEIDILEDWTAIKKARAAVSPQKRKSDGP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_056214
RefSeq Size 1455
RefSeq ORF 738
Locus ID 25855
UniProt ID Q9HCU9
Cytogenetics 11q13.2
Summary This gene reduces the metastatic potential, but not the tumorogenicity, of human breast cancer and melanoma cell lines. The protein encoded by this gene localizes primarily to the nucleus and is a component of the mSin3a family of histone deacetylase complexes (HDAC). The protein contains two coiled-coil motifs and several imperfect leucine zipper motifs. Alternative splicing results in two transcript variants encoding different isoforms. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "BRMS1" proteins (5)
SKU Description Size Price
LC414569 Lyophilized BRMS1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422568 Lyophilized BRMS1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414569 Transient overexpression lysate of breast cancer metastasis suppressor 1 (BRMS1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY422568 Transient overexpression lysate of breast cancer metastasis suppressor 1 (BRMS1), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP303428 Recombinant protein of human breast cancer metastasis suppressor 1 (BRMS1), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products