RAB25 (NM_020387) Human Mass Spec Standard

SKU
PH303413
RAB25 MS Standard C13 and N15-labeled recombinant protein (NP_065120)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203413]
Predicted MW 23.5 kDa
Protein Sequence
Protein Sequence
>RC203413 protein sequence
Red=Cloning site Green=Tags(s)

MGNGTEEDYNFVFKVVLIGESGVGKTNLLSRFTRNEFSHDSRTTIGVEFSTRTVMLGTAAVKAQIWDTAG
LERYRAITSAYYRGAVGALLVFDLTKHQTYAVVERWLKELYDHAEATIVVMLVGNKSDLSQAREVPTEEA
RMFAENNGLLFLETSALDSTNVELAFETVLKEIFAKVSKQRQNSIRTNAITLGSAQAGQEPGPGEKRACC
ISL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_065120
RefSeq Size 1101
RefSeq ORF 639
Synonyms CATX-8; RAB11C
Locus ID 57111
UniProt ID P57735
Cytogenetics 1q22
Summary The protein encoded by this gene is a member of the RAS superfamily of small GTPases. The encoded protein is involved in membrane trafficking and cell survival. This gene has been found to be a tumor suppressor and an oncogene, depending on the context. Two variants, one protein-coding and the other not, have been found for this gene. [provided by RefSeq, Nov 2015]
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:RAB25 (NM_020387) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402782 RAB25 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402782 Transient overexpression lysate of RAB25, member RAS oncogene family (RAB25) 100 ug
$436.00
TP303413 Recombinant protein of human RAB25, member RAS oncogene family (RAB25), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.