XLF (NHEJ1) (NM_024782) Human Mass Spec Standard

SKU
PH303393
NHEJ1 MS Standard C13 and N15-labeled recombinant protein (NP_079058)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203393]
Predicted MW 33.3 kDa
Protein Sequence
Protein Sequence
>RC203393 protein sequence
Red=Cloning site Green=Tags(s)

MEELEQGLLMQPWAWLQLAENSLLAKVFITKQGYALLVSDLQQVWHEQVDTSVVSQRAKELNKRLTAPPA
AFLCHLDNLLRPLLKDAAHPSEATFSCDCVADALILRVRSELSGLPFYWNFHCMLASPSLVSQHLIRPLM
GMSLALQCQVRELATLLHMKDLEIQDYQESGATLIRDRLKTEPFEENSFLEQFMIEKLPEACSIGDGKPF
VMNLQDLYMAVTTQEVQVGQKHQGAGDPHTSNSASLQGIDSQCVNQPEQLVSSAPTLSAPEKESTGTSGP
LQRPQLSKVKRKKPRGLFS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_079058
RefSeq Size 2119
RefSeq ORF 897
Synonyms XLF
Locus ID 79840
UniProt ID Q9H9Q4
Cytogenetics 2q35
Summary Double-strand breaks in DNA result from genotoxic stresses and are among the most damaging of DNA lesions. This gene encodes a DNA repair factor essential for the nonhomologous end-joining pathway, which preferentially mediates repair of double-stranded breaks. Mutations in this gene cause different kinds of severe combined immunodeficiency disorders. [provided by RefSeq, Jul 2008]
Protein Pathways Non-homologous end-joining
Write Your Own Review
You're reviewing:XLF (NHEJ1) (NM_024782) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403031 NHEJ1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403031 Transient overexpression lysate of nonhomologous end-joining factor 1 (NHEJ1) 100 ug
$436.00
TP303393 Recombinant protein of human nonhomologous end-joining factor 1 (NHEJ1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.