KIAA1191 (NM_001079685) Human Mass Spec Standard

SKU
PH303372
KIAA1191 MS Standard C13 and N15-labeled recombinant protein (NP_001073153)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203372]
Predicted MW 33.2 kDa
Protein Sequence
Protein Sequence
>RC203372 protein sequence
Red=Cloning site Green=Tags(s)

MASRQPEVPALEASAPLGKMSLPIGIYRRAVSYDDTLEDPAPMTPPPSDMGSVPWKPVIPERKYQHLAKV
EEGEASLPSPAMTLSSAIDSVDKVPVVKAKATHVIMNSLITKQTQESIQHFERQAGLRDAGYTPHKGLTT
EETKYLRVAEALHKLKLQSGEVTKEERQPASAQSTPSTTPHSSPKQRPRGWFTSGSSTALPGPNPSTMDS
GSGDKDRNLSDKWSLFGPRSLQKYDSGSFATQAYRGAQKPSPLELIRAQANRMAEDPAALKPPKMDIPVM
EGKKQPPRAHNLKPRDLNVLTPTGF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001073153
RefSeq Size 2738
RefSeq ORF 915
Synonyms p33MONOX; p60MONOX
Locus ID 57179
UniProt ID Q96A73
Cytogenetics 5q35.2
Summary Potential NADPH-dependent oxidoreductase. May be involved in the regulation of neuronal survival, differentiation and axonal outgrowth.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:KIAA1191 (NM_001079685) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH318066 KIAA1191 MS Standard C13 and N15-labeled recombinant protein (NP_065177) 10 ug
$3,255.00
LC412452 KIAA1191 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421535 KIAA1191 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421536 KIAA1191 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY412452 Transient overexpression lysate of KIAA1191 (KIAA1191), transcript variant 1 100 ug
$436.00
LY421535 Transient overexpression lysate of KIAA1191 (KIAA1191), transcript variant 2 100 ug
$436.00
LY421536 Transient overexpression lysate of KIAA1191 (KIAA1191), transcript variant 3 100 ug
$436.00
TP303372 Recombinant protein of human KIAA1191 (KIAA1191), transcript variant 3, 20 µg 20 ug
$867.00
TP318066 Recombinant protein of human KIAA1191 (KIAA1191), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.