KIAA1191 (NM_001079685) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC203372] |
Predicted MW | 33.2 kDa |
Protein Sequence |
Protein Sequence
>RC203372 protein sequence
Red=Cloning site Green=Tags(s) MASRQPEVPALEASAPLGKMSLPIGIYRRAVSYDDTLEDPAPMTPPPSDMGSVPWKPVIPERKYQHLAKV EEGEASLPSPAMTLSSAIDSVDKVPVVKAKATHVIMNSLITKQTQESIQHFERQAGLRDAGYTPHKGLTT EETKYLRVAEALHKLKLQSGEVTKEERQPASAQSTPSTTPHSSPKQRPRGWFTSGSSTALPGPNPSTMDS GSGDKDRNLSDKWSLFGPRSLQKYDSGSFATQAYRGAQKPSPLELIRAQANRMAEDPAALKPPKMDIPVM EGKKQPPRAHNLKPRDLNVLTPTGF myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001073153 |
RefSeq Size | 2738 |
RefSeq ORF | 915 |
Synonyms | p33MONOX; p60MONOX |
Locus ID | 57179 |
UniProt ID | Q96A73 |
Cytogenetics | 5q35.2 |
Summary | Potential NADPH-dependent oxidoreductase. May be involved in the regulation of neuronal survival, differentiation and axonal outgrowth.[UniProtKB/Swiss-Prot Function] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH318066 | KIAA1191 MS Standard C13 and N15-labeled recombinant protein (NP_065177) | 10 ug |
$3,255.00
|
|
LC412452 | KIAA1191 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC421535 | KIAA1191 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC421536 | KIAA1191 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY412452 | Transient overexpression lysate of KIAA1191 (KIAA1191), transcript variant 1 | 100 ug |
$436.00
|
|
LY421535 | Transient overexpression lysate of KIAA1191 (KIAA1191), transcript variant 2 | 100 ug |
$436.00
|
|
LY421536 | Transient overexpression lysate of KIAA1191 (KIAA1191), transcript variant 3 | 100 ug |
$436.00
|
|
TP303372 | Recombinant protein of human KIAA1191 (KIAA1191), transcript variant 3, 20 µg | 20 ug |
$867.00
|
|
TP318066 | Recombinant protein of human KIAA1191 (KIAA1191), transcript variant 1, 20 µg | 20 ug |
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.