RTL10 (NM_024627) Human Mass Spec Standard

SKU
PH303371
C22orf29 MS Standard C13 and N15-labeled recombinant protein (NP_078903)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203371]
Predicted MW 39.3 kDa
Protein Sequence
Protein Sequence
>RC203371 protein sequence
Red=Cloning site Green=Tags(s)

MPRGRCRQQGPRIPIWAAANYANAHPWQQMDKASPGVAYTPLVDPWIERPCCGDTVCVRTTMEQKSTASG
TCGGKPAERGPLAGHMPSSRPHRVDFCWVPGSDPGTFDGSPWLLDRFLAQLGDYMSFHFEHYQDNISRVC
EILRRLTGRAQAWAAPYLDGDLPLPDDYELFCQDLKEVVQDPNSFAEYHAVVTCPLPLASSQLPVAPQLP
VVRQYLARFLEGLALDMGTAPRSLPAAMATPAVSGSNSVSRSALFEQQLTKESTPGPKEPPVLPSSTCSS
KPGPVEPASSQPEEAAPTPVPRLSESANPPAQRPDPAHPGGPKPQKTEEEVLETEGDQEVSLGTPQEVVE
APETPGEPPLSPGF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_078903
RefSeq Size 6693
RefSeq ORF 1092
Synonyms BOP; C22orf29
Locus ID 79680
UniProt ID Q7L3V2
Cytogenetics 22q11.21
Summary Could induce apoptosis in a BH3 domain-dependent manner. The direct interaction network of Bcl-2 family members may play a key role in modulation RTL10/BOP intrinsic apoptotic signaling activity.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:RTL10 (NM_024627) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC411106 C22orf29 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411106 Transient overexpression lysate of chromosome 22 open reading frame 29 (C22orf29) 100 ug
$436.00
TP303371 Recombinant protein of human chromosome 22 open reading frame 29 (C22orf29), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.