ASAM (CLMP) (NM_024769) Human Mass Spec Standard

SKU
PH303362
ASAM MS Standard C13 and N15-labeled recombinant protein (NP_079045)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203362]
Predicted MW 41.3 kDa
Protein Sequence
Protein Sequence
>RC203362 protein sequence
Red=Cloning site Green=Tags(s)

MSLLLLLLLVSYYVGTLGTHTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQKVVITYSSRH
VYNNLTEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYVWSHVILKVLVRPSKPKCELE
GELTEGSDLTLQCESSSGTEPIVYYWQRIREKEGEDERLPPKSRIDYNHPGRVLLQNLTMSYSGLYQCTA
GNEAGKESCVVRVTVQYVQSIGMVAGAVTGIVAGALLIFLLVWLLIRRKDKERYEEEERPNEIREDAEAP
KARLVKPSSSSSGSRSSRSGSSSTRSTANSASRSQRTLSTDAAPQPGLATQAYSLVGPEVRGSEPKKVHH
ANLTKAETTPSMIPSQSRAFQTV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_079045
RefSeq Size 2645
RefSeq ORF 1119
Synonyms ACAM; ASAM; CSBM; CSBS
Locus ID 79827
UniProt ID Q9H6B4
Cytogenetics 11q24.1
Summary This gene encodes a type I transmembrane protein that is localized to junctional complexes between endothelial and epithelial cells and may have a role in cell-cell adhesion. Expression of this gene in white adipose tissue is implicated in adipocyte maturation and development of obesity. This gene is also essential for normal intestinal development and mutations in the gene are associated with congenital short bowel syndrome. [provided by RefSeq, Aug 2015]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:ASAM (CLMP) (NM_024769) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC411081 CLMP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411081 Transient overexpression lysate of adipocyte-specific adhesion molecule (ASAM) 100 ug
$436.00
TP303362 Recombinant protein of human adipocyte-specific adhesion molecule (ASAM), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720361 Recombinant protein of human adipocyte-specific adhesion molecule (ASAM) 10 ug
$230.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.