Nucleophosmin (NPM1) (NM_002520) Human Mass Spec Standard

SKU
PH303344
NPM1 MS Standard C13 and N15-labeled recombinant protein (NP_002511)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203344]
Predicted MW 32.6 kDa
Protein Sequence
Protein Sequence
>RC203344 protein sequence
Red=Cloning site Green=Tags(s)

MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGS
PIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISG
KRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQN
GKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTD
QEAIQDLWQWRKSL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002511
RefSeq Size 1449
RefSeq ORF 882
Synonyms B23; NPM
Locus ID 4869
UniProt ID P06748
Cytogenetics 5q35.1
Summary The protein encoded by this gene is involved in several cellular processes, including centrosome duplication, protein chaperoning, and cell proliferation. The encoded phosphoprotein shuttles between the nucleolus, nucleus, and cytoplasm, chaperoning ribosomal proteins and core histones from the nucleus to the cytoplasm. This protein is also known to sequester the tumor suppressor ARF in the nucleolus, protecting it from degradation until it is needed. Mutations in this gene are associated with acute myeloid leukemia. Dozens of pseudogenes of this gene have been identified. [provided by RefSeq, Aug 2017]
Protein Families Druggable Genome, Stem cell - Pluripotency, Transcription Factors
Write Your Own Review
You're reviewing:Nucleophosmin (NPM1) (NM_002520) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH303841 NPM1 MS Standard C13 and N15-labeled recombinant protein (NP_954654) 10 ug
$3,255.00
PH310458 NPM1 MS Standard C13 and N15-labeled recombinant protein (NP_001032827) 10 ug
$3,255.00
LC404681 NPM1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC419282 NPM1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421985 NPM1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY404681 Transient overexpression lysate of nucleophosmin (nucleolar phosphoprotein B23, numatrin) (NPM1), transcript variant 2 100 ug
$436.00
LY419282 Transient overexpression lysate of nucleophosmin (nucleolar phosphoprotein B23, numatrin) (NPM1), transcript variant 1 100 ug
$436.00
LY421985 Transient overexpression lysate of nucleophosmin (nucleolar phosphoprotein B23, numatrin) (NPM1), transcript variant 3 100 ug
$436.00
TP303344 Recombinant protein of human nucleophosmin (nucleolar phosphoprotein B23, numatrin) (NPM1), transcript variant 1, 20 µg 20 ug
$737.00
TP303841 Recombinant protein of human nucleophosmin (nucleolar phosphoprotein B23, numatrin) (NPM1), transcript variant 2, 20 µg 20 ug
$737.00
TP310458 Recombinant protein of human nucleophosmin (nucleolar phosphoprotein B23, numatrin) (NPM1), transcript variant 3, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.