OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CAP2 (NM_006366) Human Mass Spec Standard

Be the first to review this product
SKU
PH303332
CAP2 MS Standard C13 and N15-labeled recombinant protein (NP_006357)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA322504 Anti-CAP2 Rabbit Polyclonal Antibody
100 ul
$305.00
LY416695 Transient overexpression lysate of CAP, adenylate cyclase-associated protein, 2 (yeast) (CAP2) (as WB positive control) 100 ug
$436.00

Other products for "CAP2 or NM_006366"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203332
Predicted MW 52.8 kDa
Protein Sequence
Protein Sequence
>RC203332 protein sequence
Red=Cloning site Green=Tags(s)

MANMQGLVERLERAVSRLESLSAESHRPPGNCGEVNGVIAGVAPSVEAFDKLMDSMVAEFLKNSRILAGD
VETHAEMVHSAFQAQRAFLLMASQYQQPHENDVAALLKPISEKIQEIQTFRERNRGSNMFNHLSAVSESI
PALGWIAVSPKPGPYVKEMNDAATFYTNRVLKDYKHSDLRHVDWVKSYLNIWSELQAYIKEHHTTGLTWS
KTGPVASTVSAFSVLSSGPGLPPPPPPLPPPGPPPLFENEGKKEESSPSRSALFAQLNQGEAITKGLRHV
TDDQKTYKNPSLRAQGGQTQSPTKSHTPSPTSPKSYPSQKHAPVLELEGKKWRVEYQEDRNDLVISETEL
KQVAYIFKCEKSTIQIKGKVNSIIIDNCKKLGLVFDNVVGIVEVINSQDIQIQVMGRVPTISINKTEGCH
IYLSEDALDCEIVSAKSSEMNILIPQDGDYREFPIPEQFKTAWDGSKLITEPAEIMA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006357
RefSeq Size 3080
RefSeq ORF 1431
Locus ID 10486
UniProt ID P40123
Cytogenetics 6p22.3
Summary This gene was identified by its similarity to the gene for human adenylyl cyclase-associated protein. The function of the protein encoded by this gene is unknown. However, the protein appears to be able to interact with adenylyl cyclase-associated protein and actin. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CAP2" proteins (3)
SKU Description Size Price
LC416695 Lyophilized CAP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416695 Transient overexpression lysate of CAP, adenylate cyclase-associated protein, 2 (yeast) (CAP2) (as WB positive control) 100 ug
$436.00
TP303332 Recombinant protein of human CAP, adenylate cyclase-associated protein, 2 (yeast) (CAP2), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products