C7orf55 (FMC1) (NM_197964) Human Mass Spec Standard

SKU
PH303326
C7orf55 MS Standard C13 and N15-labeled recombinant protein (NP_932068)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203326]
Predicted MW 12.7 kDa
Protein Sequence
Protein Sequence
>RC203326 protein sequence
Red=Cloning site Green=Tags(s)

MAALGSPAHTFRGLLRELRYLSAATGRPYRDTAAYRYLVKAFRAHRVTSEKLCRAQHELHFQAATYLCLL
RSIRKHVALHQEFHGKGERSVEESAGLVGLKLPHQPGGKGWEP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_932068
RefSeq Size 1210
RefSeq ORF 339
Synonyms C7orf55; HSPC268
Locus ID 154791
UniProt ID Q96HJ9
Cytogenetics 7q34
Summary Plays a role in the assembly/stability of the mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) (PubMed:28719601).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:C7orf55 (FMC1) (NM_197964) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC405079 C7orf55 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405079 Transient overexpression lysate of chromosome 7 open reading frame 55 (C7orf55), nuclear gene encoding mitochondrial protein 100 ug
$436.00
TP303326 Recombinant protein of human chromosome 7 open reading frame 55 (C7orf55), nuclear gene encoding mitochondrial protein, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.