OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

IFIT1 (NM_001548) Human Mass Spec Standard

Be the first to review this product
SKU
PH303320
IFIT1 MS Standard C13 and N15-labeled recombinant protein (NP_001539)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA500948 IFIT1 mouse monoclonal antibody, clone OTI3G8 (formerly 3G8) 100 ul
$447.00
LY400592 Transient overexpression lysate of interferon-induced protein with tetratricopeptide repeats 1 (IFIT1), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "IFIT1 or NM_001548"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203320
Predicted MW 55.4 kDa
Protein Sequence
Protein Sequence
>RC203320 protein sequence
Red=Cloning site Green=Tags(s)

MSTNGDDHQVKDSLEQLRCHFTWELSIDDDEMPDLENRVLDQIEFLDTKYSVGIHNLLAYVKHLKGQNEE
ALKSLKEAENLMQEEHDNQANVRSLVTWGNFAWMYYHMGRLAEAQTYLDKVENICKKLSNPFRYRMECPE
IDCEEGWALLKCGGKNYERAKACFEKVLEVDPENPESSAGYAISAYRLDGFKLATKNHKPFSLLPLRQAV
RLNPDNGYIKVLLALKLQDEGQEAEGEKYIEEALANMSSQTYVFRYAAKFYRRKGSVDKALELLKKALQE
TPTSVLLHHQIGLCYKAQMIQIKEATKGQPRGQNREKLDKMIRSAIFHFESAVEKKPTFEVAHLDLARMY
IEAGNHRKAEENFQKLLCMKPVVEETMQDIHFHYGRFQEFQKKSDVNAIIHYLKAIKIEQASLTRDKSIN
SLKKLVLRKLRRKALDLESLSLLGFVYKLEGNMNEALEYYERALRLAADFENSVRQGP

TRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001539
RefSeq Size 4396
RefSeq ORF 1434
Synonyms C56; G10P1; IFI-56; IFI-56K; IFI56; IFIT-1; IFNAI1; ISG56; P56; RNM561
Locus ID 3434
UniProt ID P09914
Cytogenetics 10q23.31
Summary This gene encodes a protein containing tetratricopeptide repeats that was originally identified as induced upon treatment with interferon. The encoded protein may inhibit viral replication and translational initiation. This gene is located in a cluster on chromosome 10 with five other closely related genes. There is a pseudogene for this gene on chromosome 13. Alternatively spliced transcript variants encoding multiple isoforms have been observed. provided by RefSeq, Aug 2012
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "IFIT1" proteins (3)
SKU Description Size Price
LC400592 Lyophilized IFIT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400592 Transient overexpression lysate of interferon-induced protein with tetratricopeptide repeats 1 (IFIT1), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP303320 Recombinant protein of human interferon-induced protein with tetratricopeptide repeats 1 (IFIT1), transcript variant 2, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products