CISD1 (NM_018464) Human Mass Spec Standard

SKU PH303308

CISD1 MS Standard C13 and N15-labeled recombinant protein (NP_060934)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC203308]
• Predicted MW: 12.2 kDa
• Protein Sequence:
  Protein Sequence

  >RC203308 protein sequence; Red=Cloning site Green=Tags(s); ; MSLTSSSSVRVEWIAAVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAV; YCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_060934
• RefSeq Size: 2115
• RefSeq ORF: 324
• Synonyms: C10orf70; MDS029; mitoNEET; ZCD1
• Locus ID: 55847
• UniProt ID: Q9NZ45
• Cytogenetics: 10q21.1
• Summary: This gene encodes a protein with a CDGSH iron-sulfur domain and has been shown to bind a redox-active [2Fe-2S] cluster. The encoded protein has been localized to the outer membrane of mitochondria and is thought to play a role in regulation of oxidation. Genes encoding similar proteins are located on chromosomes 4 and 17, and a pseudogene of this gene is located on chromosome 2. [provided by RefSeq, Feb 2012]
• Protein Families: Transmembrane