UBE2B (NM_003337) Human Mass Spec Standard

SKU
PH303306
UBE2B MS Standard C13 and N15-labeled recombinant protein (NP_003328)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203306]
Predicted MW 17.1 kDa
Protein Sequence
Protein Sequence
>RC203306 representing NM_003337
Red=Cloning site Green=Tags(s)

MSTPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFSEEYPNKPPTV
RFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKR
VSAIVEQSWNDS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003328
RefSeq Size 2631
RefSeq ORF 456
Synonyms E2-17kDa; HHR6B; HR6B; RAD6B; UBC2
Locus ID 7320
UniProt ID P63146
Cytogenetics 5q31.1
Summary The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is required for post-replicative DNA damage repair. Its protein sequence is 100% identical to the mouse, rat, and rabbit homologs, which indicates that this enzyme is highly conserved in eukaryotic evolution. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways Ubiquitin mediated proteolysis
Write Your Own Review
You're reviewing:UBE2B (NM_003337) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC418755 UBE2B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY418755 Transient overexpression lysate of ubiquitin-conjugating enzyme E2B (RAD6 homolog) (UBE2B) 100 ug
$436.00
TP303306 Recombinant protein of human ubiquitin-conjugating enzyme E2B (RAD6 homolog) (UBE2B), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720719 Purified recombinant protein of Human ubiquitin-conjugating enzyme E2B (UBE2B) 10 ug
$265.00
TP720915 Purified recombinant protein of Human ubiquitin-conjugating enzyme E2B (UBE2B) 10 ug
$265.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.