HSD17B2 (NM_002153) Human Mass Spec Standard

SKU
PH303293
HSD17B2 MS Standard C13 and N15-labeled recombinant protein (NP_002144)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203293]
Predicted MW 42.8 kDa
Protein Sequence
Protein Sequence
>RC203293 protein sequence
Red=Cloning site Green=Tags(s)

MSTFFSDTAWICLAVPTVLCGTVFCKYKKSSGQLWSWMVCLAGLCAVCLLILSPFWGLILFSVSCFLMYT
YLSGQELLPVDQKAVLVTGGDCGLGHALCKYLDELGFTVFAGVLNENGPGAEELRRTCSPRLSVLQMDIT
KPVQIKDAYSKVAAMLQDRGLWAVINNAGVLGFPTDGELLLMTDYKQCMAVNFFGTVEVTKTFLPLLRKS
KGRLVNVSSMGGGAPMERLASYGSSKAAVTMFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLE
KDILDHLPAEVQEDYGQDYILAQRNFLLLINSLASKDFSPVLRDIQHAILAKSPFAYYTPGKGAYLWICL
AHYLPIGIYDYFAKRHFGQDKPMPRALRMPNYKKKAT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002144
RefSeq Size 1451
RefSeq ORF 1161
Synonyms EDH17B2; HSD17; SDR9C2
Locus ID 3294
UniProt ID P37059
Cytogenetics 16q23.3
Summary Capable of catalyzing the interconversion of testosterone and androstenedione, as well as estradiol and estrone. Also has 20-alpha-HSD activity. Uses NADH while EDH17B3 uses NADPH.[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome, Transmembrane
Protein Pathways Androgen and estrogen metabolism, Metabolic pathways
Write Your Own Review
You're reviewing:HSD17B2 (NM_002153) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC419500 HSD17B2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419500 Transient overexpression lysate of hydroxysteroid (17-beta) dehydrogenase 2 (HSD17B2) 100 ug
$436.00
TP303293 Recombinant protein of human hydroxysteroid (17-beta) dehydrogenase 2 (HSD17B2), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.