MAGEA3 (NM_005362) Human Mass Spec Standard

SKU
PH303288
MAGEA3 MS Standard C13 and N15-labeled recombinant protein (NP_005353)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203288]
Predicted MW 34.6 kDa
Protein Sequence
Protein Sequence
>RC203288 representing NM_005362
Red=Cloning site Green=Tags(s)

MPLEQRSQHCKPEEGLEARGEALGLVGAQAPATEEQEAASSSSTLVEVTLGEVPAAESPDPPQSPQGASS
LPTTMNYPLWSQSYEDSSNQEEEGPSTFPDLESEFQAALSRKVAELVHFLLLKYRAREPVTKAEMLGSVV
GNWQYFFPVIFSKASSSLQLVFGIELMEVDPIGHLYIFATCLGLSYDGLLGDNQIMPKAGLLIIVLAIIA
REGDCAPEEKIWEELSVLEVFEGREDSILGDPKKLLTQHFVQENYLEYRQVPGSDPACYEFLWGPRALVE
TSYVKVLHHMVKISGGPHISYPPLHEWVLREGEE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005353
RefSeq Size 1753
RefSeq ORF 942
Synonyms CT1.3; HIP8; HYPD; MAGE3; MAGEA6
Locus ID 4102
UniProt ID P43357
Cytogenetics Xq28
Summary This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:MAGEA3 (NM_005362) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC417358 MAGEA3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417358 Transient overexpression lysate of melanoma antigen family A, 3 (MAGEA3) 100 ug
$436.00
TP303288 Recombinant protein of human melanoma antigen family A, 3 (MAGEA3), 20 µg 20 ug
$737.00
TP760885 Purified recombinant protein of Human melanoma antigen family A, 3 (MAGEA3), full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.