MAD2 (MAD2L1) (NM_002358) Human Mass Spec Standard

SKU
PH303273
MAD2L1 MS Standard C13 and N15-labeled recombinant protein (NP_002349)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203273]
Predicted MW 23.5 kDa
Protein Sequence
Protein Sequence
>RC203273 protein sequence
Red=Cloning site Green=Tags(s)

MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVE
QLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVT
FLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002349
RefSeq Size 1453
RefSeq ORF 615
Synonyms HSMAD2; MAD2
Locus ID 4085
UniProt ID Q13257
Cytogenetics 4q27
Summary MAD2L1 is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. MAD2L1 is related to the MAD2L2 gene located on chromosome 1. A MAD2 pseudogene has been mapped to chromosome 14. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways Cell cycle, Oocyte meiosis, Progesterone-mediated oocyte maturation
Write Your Own Review
You're reviewing:MAD2 (MAD2L1) (NM_002358) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400849 MAD2L1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400849 Transient overexpression lysate of MAD2 mitotic arrest deficient-like 1 (yeast) (MAD2L1) 100 ug
$436.00
TP303273 Recombinant protein of human MAD2 mitotic arrest deficient-like 1 (yeast) (MAD2L1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.