OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PEN2 (PSENEN) (NM_172341) Human Mass Spec Standard

Be the first to review this product
SKU
PH303272
PSENEN MS Standard C13 and N15-labeled recombinant protein (NP_758844)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA306368 Rabbit Polyclonal PEN2 Antibody
100 ug
$640.00
LY403539 Transient overexpression lysate of presenilin enhancer 2 homolog (C. elegans) (PSENEN) (as WB positive control) 100 ug
$436.00

Other products for "PEN2 or NM_172341"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203272
Predicted MW 12 kDa
Protein Sequence
Protein Sequence
>RC203272 protein sequence
Red=Cloning site Green=Tags(s)

MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRSAVGFLFWVIV
LTSWITIFQIYRPRWGALGDYLSFTIPLGTP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_758844
RefSeq Size 834
RefSeq ORF 303
Synonyms ACNINV2; MDS033; MSTP064; PEN-2; PEN2
Locus ID 55851
UniProt ID Q9NZ42
Cytogenetics 19q13.12
Summary Presenilins, which are components of the gamma-secretase protein complex, are required for intramembranous processing of some type I transmembrane proteins, such as the Notch proteins and the beta-amyloid precursor protein. Signaling by Notch receptors mediates a wide range of developmental cell fates. Processing of the beta-amyloid precursor protein generates neurotoxic amyloid beta peptides, the major component of senile plaques associated with Alzheimer's disease. This gene encodes a protein that is required for Notch pathway signaling, and for the activity and accumulation of gamma-secretase. Mutations resulting in haploinsufficiency for this gene cause familial acne inversa-2 (ACNINV2). Alternative splicing results in multiple transcript variants. provided by RefSeq, Jul 2013
Protein Families Druggable Genome, Transmembrane
Protein Pathways Alzheimer's disease, Notch signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PEN2" proteins (3)
SKU Description Size Price
LC403539 Lyophilized PSENEN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403539 Transient overexpression lysate of presenilin enhancer 2 homolog (C. elegans) (PSENEN) (as WB positive control) 100 ug
$436.00
TP303272 Recombinant protein of human presenilin enhancer 2 homolog (C. elegans) (PSENEN), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products