DAP13 (NDUFA12) (NM_018838) Human Mass Spec Standard

SKU PH303265

NDUFA12 MS Standard C13 and N15-labeled recombinant protein (NP_061326)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC203265]
• Predicted MW: 17.1 kDa
• Protein Sequence:
  Protein Sequence

  >RC203265 protein sequence; Red=Cloning site Green=Tags(s); ; MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHRWVVYTTEMNG; KNTFWDVDGSMVPPEWHRWLHSMTDDPPTTKPLAARKFIWTNHKFNVTGTPEQYVPYSTTRKKIQEWIPP; STPYK; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_061326
• RefSeq Size: 592
• RefSeq ORF: 435
• Synonyms: B17.2; DAP13; MC1DN23
• Locus ID: 55967
• UniProt ID: Q9UI09
• Cytogenetics: 12q22
• Summary: This gene encodes a protein which is part of mitochondrial complex 1, part of the oxidative phosphorylation system in mitochondria. Complex 1 transfers electrons to ubiquinone from NADH which establishes a proton gradient for the generation of ATP. Mutations in this gene are associated with Leigh syndrome due to mitochondrial complex 1 deficiency. Pseudogenes of this gene are located on chromosomes 5 and 13. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2012]