Phospholipase A2 IIA (PLA2G2A) (NM_000300) Human Mass Spec Standard

SKU
PH303250
PLA2G2A MS Standard C13 and N15-labeled recombinant protein (NP_000291)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203250]
Predicted MW 16.1 kDa
Protein Sequence
Protein Sequence
>RC203250 protein sequence
Red=Cloning site Green=Tags(s)

MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGGRGSPKDATDRCCVTHDCC
YKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFARNKTTYNKKYQYYSNKHCRGS
TPRC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000291
RefSeq Size 1017
RefSeq ORF 432
Synonyms MOM1; PLA2; PLA2B; PLA2L; PLA2S; PLAS1; sPLA2
Locus ID 5320
UniProt ID P14555
Cytogenetics 1p36.13
Summary The protein encoded by this gene is a member of the phospholipase A2 family (PLA2). PLA2s constitute a diverse family of enzymes with respect to sequence, function, localization, and divalent cation requirements. This gene product belongs to group II, which contains secreted form of PLA2, an extracellular enzyme that has a low molecular mass and requires calcium ions for catalysis. It catalyzes the hydrolysis of the sn-2 fatty acid acyl ester bond of phosphoglycerides, releasing free fatty acids and lysophospholipids, and thought to participate in the regulation of the phospholipid metabolism in biomembranes. Several alternatively spliced transcript variants with different 5' UTRs have been found for this gene.[provided by RefSeq, Sep 2009]
Protein Families Druggable Genome, Transmembrane
Protein Pathways alpha-Linolenic acid metabolism, Arachidonic acid metabolism, Ether lipid metabolism, Fc epsilon RI signaling pathway, Glycerophospholipid metabolism, GnRH signaling pathway, Linoleic acid metabolism, Long-term depression, MAPK signaling pathway, Metabolic pathways, Vascular smooth muscle contraction, VEGF signaling pathway
Write Your Own Review
You're reviewing:Phospholipase A2 IIA (PLA2G2A) (NM_000300) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC424814 PLA2G2A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431765 PLA2G2A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431766 PLA2G2A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431767 PLA2G2A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY424814 Transient overexpression lysate of phospholipase A2, group IIA (platelets, synovial fluid) (PLA2G2A), transcript variant 1 100 ug
$436.00
LY431765 Transient overexpression lysate of phospholipase A2, group IIA (platelets, synovial fluid) (PLA2G2A), transcript variant 2 100 ug
$436.00
LY431766 Transient overexpression lysate of phospholipase A2, group IIA (platelets, synovial fluid) (PLA2G2A), transcript variant 3 100 ug
$436.00
LY431767 Transient overexpression lysate of phospholipase A2, group IIA (platelets, synovial fluid) (PLA2G2A), transcript variant 4 100 ug
$436.00
TP303250 Recombinant protein of human phospholipase A2, group IIA (platelets, synovial fluid) (PLA2G2A), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.