Inhibin beta A (INHBA) (NM_002192) Human Mass Spec Standard

SKU
PH303226
INHBA MS Standard C13 and N15-labeled recombinant protein (NP_002183)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203226]
Predicted MW 47.4 kDa
Protein Sequence
Protein Sequence
>RC203226 protein sequence
Red=Cloning site Green=Tags(s)

MPLLWLRGFLLASCWIIVRSSPTPGSEGHSAAPDCPSCALAALPKDVPNSQPEMVEAVKKHILNMLHLKK
RPDVTQPVPKAALLNAIRKLHVGKVGENGYVEIEDDIGRRAEMNELMEQTSEIITFAESGTARKTLHFEI
SKEGSDLSVVERAEVWLFLKVPKANRTRTKVTIRLFQQQKHPQGSLDTGEEAEEVGLKGERSELLLSEKV
VDARKSTWHVFPVSSSIQRLLDQGKSSLDVRIACEQCQESGASLVLLGKKKKKEEEGEGKKKGGGEGGAG
ADEEKEQSHRPFLMLQARQSEDHPHRRRRRGLECDGKVNICCKKQFFVSFKDIGWNDWIIAPSGYHANYC
EGECPSHIAGTSGSSLSFHSTVINHYRMRGHSPFANLKSCCVPTKLRPMSMLYYDDGQNIIKKDIQNMIV
EECGCS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002183
RefSeq Size 2175
RefSeq ORF 1278
Synonyms EDF; FRP
Locus ID 3624
UniProt ID P08476
Cytogenetics 7p14.1
Summary This gene encodes a member of the TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate a subunit of the dimeric activin and inhibin protein complexes. These complexes activate and inhibit, respectively, follicle stimulating hormone secretion from the pituitary gland. The encoded protein also plays a role in eye, tooth and testis development. Elevated expression of this gene may be associated with cancer cachexia in human patients. [provided by RefSeq, Aug 2016]
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Cytokine-cytokine receptor interaction, TGF-beta signaling pathway
Write Your Own Review
You're reviewing:Inhibin beta A (INHBA) (NM_002192) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400796 INHBA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400796 Transient overexpression lysate of inhibin, beta A (INHBA) 100 ug
$436.00
TP303226 Recombinant protein of human inhibin, beta A (INHBA), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP762679 Purified recombinant protein of Human inhibin, beta A (INHBA), 259Lys-End, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.