NAT8 (NM_003960) Human Mass Spec Standard

SKU PH303157

NAT8 MS Standard C13 and N15-labeled recombinant protein (NP_003951)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC203157]
• Predicted MW: 25.6 kDa
• Protein Sequence:
  Protein Sequence

  >RC203157 protein sequence; Red=Cloning site Green=Tags(s); ; MAPCHIRKYQESDRQWVVGLLSRGMAEHAPATFRQLLKLPRTLILLLGGPLALLLVSGSWLLALVFSISL; FPALWFLAKKPWTEYVDMTLCTDMSDITKSYLSERGSCFWVAESEEKVVGMVGALPVDDPTLREKRLQLF; HLFVDSEHRRQGIAKALVRTVLQFARDQGYSEVILDTGTIQLSAMALYQSMGFKKTGQSFFCVWARLVAL; HTVHFIYHLPSSKVGSQ; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_003951
• RefSeq Size: 1073
• RefSeq ORF: 681
• Synonyms: ATase2; CCNAT; CML1; GLA; Hcml1; TSC501; TSC510
• Locus ID: 9027
• UniProt ID: Q9UHE5
• Cytogenetics: 2p13.1
• Summary: This gene, isolated using the differential display method to detect tissue-specific genes, is specifically expressed in kidney and liver. The encoded protein shows amino acid sequence similarity to N-acetyltransferases. A similar protein in Xenopus affects cell adhesion and gastrulation movements, and may be localized in the secretory pathway. A highly similar paralog is found in a cluster with this gene. [provided by RefSeq, Sep 2008]
• Protein Families: Transmembrane