Tissue Factor (F3) (NM_001993) Human Mass Spec Standard

SKU
PH303142
F3 MS Standard C13 and N15-labeled recombinant protein (NP_001984)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203142]
Predicted MW 33.1 kDa
Protein Sequence
Protein Sequence
>RC203142 protein sequence
Red=Cloning site Green=Tags(s)

METPAWPRVPRPETAVARTLLLGWVFAQVAGASGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQI
STKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNL
GQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLID
VDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFREIFYIIGAVVFVVIILVIILAISLHKCRKA
GVGQSWKENSPLNVS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001984
RefSeq Size 2393
RefSeq ORF 885
Synonyms CD142; TF; TFA
Locus ID 2152
UniProt ID P13726
Cytogenetics 1p21.3
Summary This gene encodes coagulation factor III which is a cell surface glycoprotein. This factor enables cells to initiate the blood coagulation cascades, and it functions as the high-affinity receptor for the coagulation factor VII. The resulting complex provides a catalytic event that is responsible for initiation of the coagulation protease cascades by specific limited proteolysis. Unlike the other cofactors of these protease cascades, which circulate as nonfunctional precursors, this factor is a potent initiator that is fully functional when expressed on cell surfaces, for example, on monocytes. There are 3 distinct domains of this factor: extracellular, transmembrane, and cytoplasmic. Platelets and monocytes have been shown to express this coagulation factor under procoagulatory and proinflammatory stimuli, and a major role in HIV-associated coagulopathy has been described. Platelet-dependent monocyte expression of coagulation factor III has been described to be associated with Coronavirus Disease 2019 (COVID-19) severity and mortality. This protein is the only one in the coagulation pathway for which a congenital deficiency has not been described. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Aug 2020]
Protein Families Druggable Genome, Transmembrane
Protein Pathways Complement and coagulation cascades
Write Your Own Review
You're reviewing:Tissue Factor (F3) (NM_001993) Human Mass Spec Standard
Your Rating
SKU Description Size Price
TP303142 Recombinant protein of human coagulation factor III (thromboplastin, tissue factor) (F3), 20 µg 20 ug
$737.00
TP504046 Purified recombinant protein of Mouse coagulation factor III (F3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug 20 ug
$988.00
TP720578 Recombinant protein of Homo sapien Tissue Factor/TF is produced by our mammalian expression system in human cells. The target protein is expressed with human TF fused with a polyhistidine tag at the C-terminus. 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.