IP10 (CXCL10) (NM_001565) Human Mass Spec Standard

SKU PH303141

CXCL10 MS Standard C13 and N15-labeled recombinant protein (NP_001556)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC203141]
• Predicted MW: 10.9 kDa
• Protein Sequence:
  Protein Sequence

  >RC203141 protein sequence; Red=Cloning site Green=Tags(s); ; MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKG; EKRCLNPESKAIKNLLKAVSKERSKRSP; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_001556
• RefSeq Size: 1227
• RefSeq ORF: 294
• Synonyms: C7; crg-2; gIP-10; IFI10; INP10; IP-10; mob-1; SCYB10
• Locus ID: 3627
• UniProt ID: P02778
• Cytogenetics: 4q21.1
• Summary: This antimicrobial gene encodes a chemokine of the CXC subfamily and ligand for the receptor CXCR3. Binding of this protein to CXCR3 results in pleiotropic effects, including stimulation of monocytes, natural killer and T-cell migration, and modulation of adhesion molecule expression. This gene may also be a key regulator of the 'cytokine storm' immune response to SARS-CoV-2 infection. [provided by RefSeq, Sep 2020]
• Protein Families: Druggable Genome, Secreted Protein, Transmembrane
• Protein Pathways: Chemokine signaling pathway, Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway