Tetranectin (CLEC3B) (NM_003278) Human Mass Spec Standard

SKU
PH303128
CLEC3B MS Standard C13 and N15-labeled recombinant protein (NP_003269)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203128]
Predicted MW 22.6 kDa
Protein Sequence
Protein Sequence
>RC203128 protein sequence
Red=Cloning site Green=Tags(s)

MELWGAYLLLCLFSLLTQVTTEPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTV
CLKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLSTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAA
EGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003269
RefSeq Size 886
RefSeq ORF 606
Synonyms TN; TNA
Locus ID 7123
UniProt ID P05452
Cytogenetics 3p21.31
Summary Tetranectin binds to plasminogen and to isolated kringle 4. May be involved in the packaging of molecules destined for exocytosis.[UniProtKB/Swiss-Prot Function]
Protein Families Secreted Protein
Write Your Own Review
You're reviewing:Tetranectin (CLEC3B) (NM_003278) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC418793 CLEC3B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY418793 Transient overexpression lysate of C-type lectin domain family 3, member B (CLEC3B) 100 ug
$436.00
TP303128 Recombinant protein of human C-type lectin domain family 3, member B (CLEC3B), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720380 Recombinant protein of human C-type lectin domain family 3, member B (CLEC3B) 10 ug
$230.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.