HRSP12 (RIDA) (NM_005836) Human Mass Spec Standard

SKU PH303107

HRSP12 MS Standard C13 and N15-labeled recombinant protein (NP_005827)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC203107]
• Predicted MW: 14.5 kDa
• Protein Sequence:
  Protein Sequence

  >RC203107 protein sequence; Red=Cloning site Green=Tags(s); ; MSSLIRRVISTAKAPGAIGPYSQAVLVDRTIYISGQIGMDPSSGQLVSGGVAEEAKQALKNMGEILKAAG; CDFTNVVKTTVLLADINDFNTVNEIYKQYFKSNFPARAAYQVAALPKGSRIEIEAVAIQGPLTTASL; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_005827
• RefSeq Size: 1011
• RefSeq ORF: 411
• Synonyms: hp14.5; HRSP12; P14.5; PSP; UK114
• Locus ID: 10247
• UniProt ID: P52758
• Cytogenetics: 8q22.2
• Summary: Catalyzes the hydrolytic deamination of enamine/imine intermediates that form during the course of normal metabolism. May facilitate the release of ammonia from these potentially toxic reactive metabolites, reducing their impact on cellular components. It may act on enamine/imine intermediates formed by several types of pyridoxal-5'-phosphate-dependent dehydratases including L-threonine dehydratase.[UniProtKB/Swiss-Prot Function]