OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RAB32 (NM_006834) Human Mass Spec Standard

Be the first to review this product
SKU
PH303094
RAB32 MS Standard C13 and N15-labeled recombinant protein (NP_006825)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA362021 RAB32 Antibody - middle region
100 ul
$585.00
LY402044 Transient overexpression lysate of RAB32, member RAS oncogene family (RAB32) (as WB positive control) 100 ug
$436.00

Other products for "RAB32 or NM_006834"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203094
Predicted MW 25 kDa
Protein Sequence
Protein Sequence
>RC203094 protein sequence
Red=Cloning site Green=Tags(s)

MAGGGAGDPGLGAAAAPAPETREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWD
SRTLVRLQLWDIAGQERFGNMTRVYYKEAVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPAVL
LANKCDQNKDSSQSPSQVDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKILVNHQSFPNEENDVDKIK
LDQETLRAENKSQCC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006825
RefSeq Size 1234
RefSeq ORF 675
Locus ID 10981
UniProt ID Q13637
Cytogenetics 6q24.3
Summary The protein encoded by this gene anchors the type II regulatory subunit of protein kinase A to the mitochondrion and aids in mitochondrial fission. The encoded protein also appears to be involved in autophagy and melanosome secretion. Variations in this gene may be linked to leprosy. provided by RefSeq, Dec 2015
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RAB32" proteins (3)
SKU Description Size Price
LC402044 Lyophilized RAB32 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402044 Transient overexpression lysate of RAB32, member RAS oncogene family (RAB32) (as WB positive control) 100 ug
$436.00
TP303094 Recombinant protein of human RAB32, member RAS oncogene family (RAB32), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products