RAB32 (NM_006834) Human Mass Spec Standard

SKU
PH303094
RAB32 MS Standard C13 and N15-labeled recombinant protein (NP_006825)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203094]
Predicted MW 25 kDa
Protein Sequence
Protein Sequence
>RC203094 protein sequence
Red=Cloning site Green=Tags(s)

MAGGGAGDPGLGAAAAPAPETREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWD
SRTLVRLQLWDIAGQERFGNMTRVYYKEAVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPAVL
LANKCDQNKDSSQSPSQVDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKILVNHQSFPNEENDVDKIK
LDQETLRAENKSQCC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006825
RefSeq Size 1234
RefSeq ORF 675
Locus ID 10981
UniProt ID Q13637
Cytogenetics 6q24.3
Summary The protein encoded by this gene anchors the type II regulatory subunit of protein kinase A to the mitochondrion and aids in mitochondrial fission. The encoded protein also appears to be involved in autophagy and melanosome secretion. Variations in this gene may be linked to leprosy. [provided by RefSeq, Dec 2015]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:RAB32 (NM_006834) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402044 RAB32 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402044 Transient overexpression lysate of RAB32, member RAS oncogene family (RAB32) 100 ug
$436.00
TP303094 Recombinant protein of human RAB32, member RAS oncogene family (RAB32), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.