OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ORMDL2 (NM_014182) Human Mass Spec Standard

Be the first to review this product
SKU
PH303051
ORMDL2 MS Standard C13 and N15-labeled recombinant protein (NP_054901)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA360426 ORMDL2 Antibody - N-terminal region
100 ul
$585.00
LY402286 Transient overexpression lysate of ORM1-like 2 (S. cerevisiae) (ORMDL2) (as WB positive control) 100 ug
$436.00

Other products for "ORMDL2 or NM_014182"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203051
Predicted MW 17.4 kDa
Protein Sequence
Protein Sequence
>RC203051 protein sequence
Red=Cloning site Green=Tags(s)

MNVGVAHSEVNPNTRVMNSRGIWLAYIILVGLLHMVLLSIPFFSIPVVWTLTNVIHNLATYVFLHTVKGT
PFETPDQGKARLLTHWEQMDYGLQFTSSRKFLSISPIVLYLLASFYTKYDAAHFLINTASLLSVLLPKLP
QFHGVRVFGINKY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_054901
RefSeq Size 1361
RefSeq ORF 459
Synonyms adoplin-2; HSPC160; MST095; MSTP095
Locus ID 29095
UniProt ID Q53FV1
Cytogenetics 12q13.2
Summary Negative regulator of sphingolipid synthesis.UniProtKB/Swiss-Prot Function
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ORMDL2" proteins (3)
SKU Description Size Price
LC402286 Lyophilized ORMDL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402286 Transient overexpression lysate of ORM1-like 2 (S. cerevisiae) (ORMDL2) (as WB positive control) 100 ug
$436.00
TP303051 Recombinant protein of human ORM1-like 2 (S. cerevisiae) (ORMDL2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products