C16orf13 (METTL26) (NM_001040161) Human Mass Spec Standard

SKU
PH303002
C16orf13 MS Standard C13 and N15-labeled recombinant protein (NP_001035251)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203002]
Predicted MW 12 kDa
Protein Sequence
Protein Sequence
>RC203002 protein sequence
Red=Cloning site Green=Tags(s)

MLVAAAAERNKDPILHVLRQYLDPAQRGVRVLEVASGSGQHAAHFARAFPLAEWQPSDVDQRCLDRNPEW
GLRDTALLEDLGKASGLLLERMVDMPANNKCLIFRKN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001035251
RefSeq Size 570
RefSeq ORF 321
Synonyms C16orf13; JFP2
Locus ID 84326
UniProt ID Q96S19
Cytogenetics 16p13.3
Write Your Own Review
You're reviewing:C16orf13 (METTL26) (NM_001040161) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH318337 C16orf13 MS Standard C13 and N15-labeled recombinant protein (NP_115742) 10 ug
$3,255.00
LC410160 C16orf13 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421703 C16orf13 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410160 Transient overexpression lysate of chromosome 16 open reading frame 13 (C16orf13), transcript variant 1 100 ug
$436.00
LY421703 Transient overexpression lysate of chromosome 16 open reading frame 13 (C16orf13), transcript variant 3 100 ug
$436.00
TP303002 Recombinant protein of human chromosome 16 open reading frame 13 (C16orf13), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP318337 Recombinant protein of human chromosome 16 open reading frame 13 (C16orf13), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.