MGC13096 (PDCD2L) (NM_032346) Human Mass Spec Standard

SKU
PH302997
PDCD2L MS Standard C13 and N15-labeled recombinant protein (NP_115722)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202997]
Predicted MW 39.4 kDa
Protein Sequence
Protein Sequence
>RC202997 protein sequence
Red=Cloning site Green=Tags(s)

MAAVLKPVLLGLRDAPVHGSPTGPGAWTASKLGGIPDALPTVAAPRPVCQRCGQPLALVVQVYCPLEGSP
FHRLLHVFACACPGCSTGGARSWKVFRSQCLQVPEREAQDAQKQGNSLAAEDWCEGADDWGSDTEEGPSP
QFTLDFGNDASSAKDVDWTARLQDLRLQDAVLGAAHPVPPGLPLFLPYYICVADEDDYRDFVNLDHAHSL
LRDYQQREGIAMDQLLSQSLPNDGDEKYEKTIIKSGDQTFYKFMKRIAACQEQILRYSWSGEPLFLTCPT
SEVTELPACSQCGGQRIFEFQLMPALVSMLKSANLGLSVEFGTILVYTCEKSCWPPNHQTPMEEFCIIQE
DPDELLFK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_115722
RefSeq Size 1174
RefSeq ORF 1074
Locus ID 84306
UniProt ID Q9BRP1
Cytogenetics 19q13.11
Summary Over-expression suppresses AP1, CREB, NFAT, and NF-kB transcriptional activation, and delays cell cycle progression at S phase.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:MGC13096 (PDCD2L) (NM_032346) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC410183 PDCD2L HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410183 Transient overexpression lysate of programmed cell death 2-like (PDCD2L) 100 ug
$436.00
TP302997 Recombinant protein of human programmed cell death 2-like (PDCD2L), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.