ETEA (FAF2) (NM_014613) Human Mass Spec Standard

SKU
PH302996
FAF2 MS Standard C13 and N15-labeled recombinant protein (NP_055428)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202996]
Predicted MW 52.4 kDa
Protein Sequence
Protein Sequence
>RC202996 representing NM_014613
Red=Cloning site Green=Tags(s)

MAAPEERDLTQEQTEKLLQFQDLTGIESMDQCRHTLEQHNWNIEAAVQDRLNEQEGVPSVFNPPPSRPLQ
VNTADHRIYSYVVSRPQPRGLLGWGYYLIMLPFRFTYYTILDIFRFALRFIRPDPRSRVTDPVGDIVSFM
HSFEEKYGRAHPVFYQGTYSQALNDAKRELRFLLVYLHGDDHQDSDEFCRNTLCAPEVISLINTRMLFWA
CSTNKPEGYRVSQALRENTYPFLAMIMLKDRRMTVVGRLEGLIQPDDLINQLTFIMDANQTYLVSERLER
EERNQTQVLRQQQDEAYLASLRADQEKERKKREERERKRRKEEEVQQQKLAEERRRQNLQEEKERKLECL
PPEPSPDDPESVKIIFKLPNDSRVERRFHFSQSLTVIHDFLFSLKESPEKFQIEANFPRRVLPCIPSEEW
PNPPTLQEAGLSHTEVLFVQDLTDE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055428
RefSeq Size 4515
RefSeq ORF 1335
Synonyms ETEA; UBXD8; UBXN3B
Locus ID 23197
UniProt ID Q96CS3
Cytogenetics 5q35.2
Summary The protein encoded by this gene is highly expressed in peripheral blood of patients with atopic dermatitis (AD), compared to normal individuals. It may play a role in regulating the resistance to apoptosis that is observed in T cells and eosinophils of AD patients. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:ETEA (FAF2) (NM_014613) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC415165 FAF2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415165 Transient overexpression lysate of Fas associated factor family member 2 (FAF2) 100 ug
$436.00
TP302996 Purified recombinant protein of Homo sapiens Fas associated factor family member 2 (FAF2), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.