SHD (NM_020209) Human Mass Spec Standard

SKU
PH302986
SHD MS Standard C13 and N15-labeled recombinant protein (NP_064594)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202986]
Predicted MW 38.3 kDa
Protein Sequence
Protein Sequence
>RC202986 protein sequence
Red=Cloning site Green=Tags(s)

MAKWLRDYLSFGGRRPPPQPPTPDYTESDILRAYRAQKNLDFEDPYEDAESRLEPDPAGPGDSKNPGDAK
YGSPKHRLIKVEAADMARAKALLGGPGEELEADTEYLDPFDAQPHPAPPDDGYMEPYDAQWVMSELPGRG
VQLYDTPYEEQDPETADGPPSGQKPRQSRMPQEDERPADEYDQPWEWKKDHISRAFAVQFDSPEWERTPG
SAKELRRPPPRSPQPAERVDPALPLEKQPWFHGPLNRADAESLLSLCKEGSYLVRLSETNPQDCSLSLRS
SQGFLHLKFARTRENQVVLGQHSGPFPSVPELVLHYSSRPLPVQGAEHLALLYPVVTQTP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_064594
RefSeq Size 2598
RefSeq ORF 1020
Locus ID 56961
UniProt ID Q96IW2
Cytogenetics 19p13.3
Summary May function as an adapter protein.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:SHD (NM_020209) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC412594 SHD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY412594 Transient overexpression lysate of Src homology 2 domain containing transforming protein D (SHD) 100 ug
$436.00
TP302986 Recombinant protein of human Src homology 2 domain containing transforming protein D (SHD), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.