NUDT22 (NM_032344) Human Mass Spec Standard

SKU
PH302982
NUDT22 MS Standard C13 and N15-labeled recombinant protein (NP_115720)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202982]
Predicted MW 32.6 kDa
Protein Sequence
Protein Sequence
>RC202982 protein sequence
Red=Cloning site Green=Tags(s)

MDPEVTLLLQCPGGGLPQEQIQAELSPAHDRRPLPGGDEAITAIWETRLKAQPWLFDAPKFRLHSATLAP
IGSRGPQLLLRLGLTSYRDFLGTNWSSSAAWLRQQGATDWGDTQAYLADPLGVGAALATADDFLVFLRRS
RQVAEAPGLVDVPGGHPEPQALCPGGSPQHQDLAGQLVVHELFSSVLQEICDEVNLPLLTLSQPLLLGIA
RNETSAGRASAEFYVQCSLTSEQVRKHYLSGGPEAHESTGIFFVETQNVRRLPETEMWAELCPSAKGAII
LYNRVQGSPTGAALGSPALLPPL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_115720
RefSeq Size 1141
RefSeq ORF 909
Locus ID 84304
UniProt ID Q9BRQ3
Cytogenetics 11q13.1
Summary Hydrolyzes UDP-glucose to glucose 1-phosphate and UMP and UDP-galactose to galactose 1-phosphate and UMP. Preferred substrate is UDP-glucose.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:NUDT22 (NM_032344) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC410181 NUDT22 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426974 NUDT22 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426975 NUDT22 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410181 Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 22 (NUDT22), transcript variant 1 100 ug
$436.00
LY426974 Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 22 (NUDT22), transcript variant 2 100 ug
$436.00
LY426975 Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 22 (NUDT22), transcript variant 3 100 ug
$436.00
TP302982 Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 22 (NUDT22), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.