OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NUDT22 (NM_032344) Human Mass Spec Standard

Be the first to review this product
SKU
PH302982
NUDT22 MS Standard C13 and N15-labeled recombinant protein (NP_115720)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA365272 NUDT22 rabbit polyclonal antibody
100 ul
$310.00
LY410181 Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 22 (NUDT22), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "NUDT22 or NM_032344"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202982
Predicted MW 32.6 kDa
Protein Sequence
Protein Sequence
>RC202982 protein sequence
Red=Cloning site Green=Tags(s)

MDPEVTLLLQCPGGGLPQEQIQAELSPAHDRRPLPGGDEAITAIWETRLKAQPWLFDAPKFRLHSATLAP
IGSRGPQLLLRLGLTSYRDFLGTNWSSSAAWLRQQGATDWGDTQAYLADPLGVGAALATADDFLVFLRRS
RQVAEAPGLVDVPGGHPEPQALCPGGSPQHQDLAGQLVVHELFSSVLQEICDEVNLPLLTLSQPLLLGIA
RNETSAGRASAEFYVQCSLTSEQVRKHYLSGGPEAHESTGIFFVETQNVRRLPETEMWAELCPSAKGAII
LYNRVQGSPTGAALGSPALLPPL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_115720
RefSeq Size 1141
RefSeq ORF 909
Locus ID 84304
UniProt ID Q9BRQ3
Cytogenetics 11q13.1
Summary Hydrolyzes UDP-glucose to glucose 1-phosphate and UMP and UDP-galactose to galactose 1-phosphate and UMP. Preferred substrate is UDP-glucose.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NUDT22" proteins (7)
SKU Description Size Price
LC410181 Lyophilized NUDT22 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426974 Lyophilized NUDT22 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426975 Lyophilized NUDT22 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410181 Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 22 (NUDT22), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY426974 Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 22 (NUDT22), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY426975 Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 22 (NUDT22), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP302982 Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 22 (NUDT22), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products