QPRT (NM_014298) Human Mass Spec Standard

SKU
PH302960
QPRT MS Standard C13 and N15-labeled recombinant protein (NP_055113)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202960]
Predicted MW 30.8 kDa
Protein Sequence
Protein Sequence
>RC202960 protein sequence
Red=Cloning site Green=Tags(s)

MDAEGLALLLPPVTLAALVDSWLREDCPGLNYAALVSGAGPSQAALWAKSPGILAGQPFFDAIFTQLNCQ
VSWFLPEGSKLVPVARVAEVRGPAHCLLLGERVALNTLARCSGIASAAAAAVEAARGAGWTGHVAGTRKT
TPGFRLVEKYGLLVGGAASHRYDLGGLVMVKDNHVVAAGGVEKAVRAARQAADFALKVEVECSSLQEAVQ
AAEAGADLVLLDNFKPEELHPTATVLKAQFPSVAVEASGGITLDNLPQFCGPHIDVISMGMLTQAAPALD
FSLKLFAKEVAPVPKIH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055113
RefSeq Size 1575
RefSeq ORF 891
Synonyms HEL-S-90n; QPRTase
Locus ID 23475
UniProt ID Q15274
Cytogenetics 16p11.2
Summary This gene encodes a key enzyme in catabolism of quinolinate, an intermediate in the tryptophan-nicotinamide adenine dinucleotide pathway. Quinolinate acts as a most potent endogenous exitotoxin to neurons. Elevation of quinolinate levels in the brain has been linked to the pathogenesis of neurodegenerative disorders such as epilepsy, Alzheimer's disease, and Huntington's disease. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]
Protein Pathways Metabolic pathways, Nicotinate and nicotinamide metabolism
Write Your Own Review
You're reviewing:QPRT (NM_014298) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402307 QPRT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402307 Transient overexpression lysate of quinolinate phosphoribosyltransferase (QPRT) 100 ug
$436.00
TP302960 Recombinant protein of human quinolinate phosphoribosyltransferase (QPRT), 20 µg 20 ug
$737.00
TP720230 Recombinant protein of human quinolinate phosphoribosyltransferase (QPRT) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.