QPRT (NM_014298) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC202960] |
Predicted MW | 30.8 kDa |
Protein Sequence |
Protein Sequence
>RC202960 protein sequence
Red=Cloning site Green=Tags(s) MDAEGLALLLPPVTLAALVDSWLREDCPGLNYAALVSGAGPSQAALWAKSPGILAGQPFFDAIFTQLNCQ VSWFLPEGSKLVPVARVAEVRGPAHCLLLGERVALNTLARCSGIASAAAAAVEAARGAGWTGHVAGTRKT TPGFRLVEKYGLLVGGAASHRYDLGGLVMVKDNHVVAAGGVEKAVRAARQAADFALKVEVECSSLQEAVQ AAEAGADLVLLDNFKPEELHPTATVLKAQFPSVAVEASGGITLDNLPQFCGPHIDVISMGMLTQAAPALD FSLKLFAKEVAPVPKIH myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_055113 |
RefSeq Size | 1575 |
RefSeq ORF | 891 |
Synonyms | HEL-S-90n; QPRTase |
Locus ID | 23475 |
UniProt ID | Q15274 |
Cytogenetics | 16p11.2 |
Summary | This gene encodes a key enzyme in catabolism of quinolinate, an intermediate in the tryptophan-nicotinamide adenine dinucleotide pathway. Quinolinate acts as a most potent endogenous exitotoxin to neurons. Elevation of quinolinate levels in the brain has been linked to the pathogenesis of neurodegenerative disorders such as epilepsy, Alzheimer's disease, and Huntington's disease. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015] |
Protein Pathways | Metabolic pathways, Nicotinate and nicotinamide metabolism |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC402307 | QPRT HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY402307 | Transient overexpression lysate of quinolinate phosphoribosyltransferase (QPRT) | 100 ug |
$436.00
|
|
TP302960 | Recombinant protein of human quinolinate phosphoribosyltransferase (QPRT), 20 µg | 20 ug |
$737.00
|
|
TP720230 | Recombinant protein of human quinolinate phosphoribosyltransferase (QPRT) | 10 ug |
$330.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.