Neuropilin 1 (NRP1) (NM_001024629) Human Mass Spec Standard

SKU
PH302952
NRP1 MS Standard C13 and N15-labeled recombinant protein (NP_001019800)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202952]
Predicted MW 68.3 kDa
Protein Sequence
Protein Sequence
>RC202952 protein sequence
Red=Cloning site Green=Tags(s)

MERGLPLLCAVLALVLAPAGAFRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQAPDPYQRIMIN
FNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLFIKFVSDYETHGAGFSIRYEI
FKRGPECSQNYTTPSGVIKSPGFPEKYPNSLECTYIVFAPKMSEIILEFESFDLEPDSNPPGGMFCRYDR
LEIWDGFPDVGPHIGRYCGQKTPGRIRSSSGILSMVFYTDSAIAKEGFSANYSVLQSSVSEDFKCMEALG
MESGEIHSDQITASSQYSTNWSAERSRLNYPENGWTPGEDSYREWIQVDLGLLRFVTAVGTQGAISKETK
KKYYVKTYKIDVSSNGEDWITIKEGNKPVLFQGNTNPTDVVVAVFPKPLITRFVRIKPATWETGISMRFE
VYGCKITDYPCSGMLGMVSGLISDSQITSSNQGDRNWMPENIRLVTSRSGWALPPAPHSYINEWLQIDLG
EEKIVRGIIIQGGKHRENKVFMRKFKIGYSNNGSDWKMIMDDSKRKAKSFEGNNNYDTPELRTFPALSTR
FIRIYPERATHGGLGLRMELLGCEVEGGTTVLATEKPTVIDSTIQSGIK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001019800
RefSeq Size 2373
RefSeq ORF 1827
Synonyms BDCA4; CD304; NP1; NRP; VEGF165R
Locus ID 8829
UniProt ID O14786
Cytogenetics 10p11.22
Summary This gene encodes one of two neuropilins, which contain specific protein domains which allow them to participate in several different types of signaling pathways that control cell migration. Neuropilins contain a large N-terminal extracellular domain, made up of complement-binding, coagulation factor V/VIII, and meprin domains. These proteins also contains a short membrane-spanning domain and a small cytoplasmic domain. Neuropilins bind many ligands and various types of co-receptors; they affect cell survival, migration, and attraction. Some of the ligands and co-receptors bound by neuropilins are vascular endothelial growth factor (VEGF) and semaphorin family members. This protein has also been determined to act as a co-receptor for SARS-CoV-2 (which causes COVID-19) to infect host cells. [provided by RefSeq, Nov 2020]
Protein Families Druggable Genome, Secreted Protein, Transmembrane
Protein Pathways Axon guidance
Write Your Own Review
You're reviewing:Neuropilin 1 (NRP1) (NM_001024629) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH303508 NRP1 MS Standard C13 and N15-labeled recombinant protein (NP_001019799) 10 ug
$3,255.00
LC401276 NRP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422521 NRP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422522 NRP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401276 Transient overexpression lysate of neuropilin 1 (NRP1), transcript variant 1 100 ug
$665.00
LY422521 Transient overexpression lysate of neuropilin 1 (NRP1), transcript variant 2 100 ug
$436.00
LY422522 Transient overexpression lysate of neuropilin 1 (NRP1), transcript variant 3 100 ug
$436.00
TP302952 Recombinant protein of human neuropilin 1 (NRP1), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP303508 Recombinant protein of human neuropilin 1 (NRP1), transcript variant 2, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.