TACO1 (NM_016360) Human Mass Spec Standard

SKU
PH302948
TACO1 MS Standard C13 and N15-labeled recombinant protein (NP_057444)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202948]
Predicted MW 32.5 kDa
Protein Sequence
Protein Sequence
>RC202948 protein sequence
Red=Cloning site Green=Tags(s)

MSAWAAASLSRAAARCLLARGPGVRAAPPRDPRPSHPEPRGCGAAPGRTLHFTAAVPAGHNKWSKVRHIK
GPKDVERSRIFSKLCLNIRLAVKEGGPNPEHNSNLANILEVCRSKHMPKSTIETALKMEKSKDTYLLYEG
RGPGGSSLLIEALSNSSHKCQADIRHILNKNGGVMAVGARHSFDKKGVIVVEVEDREKKAVNLERALEMA
IEAGAEDVKETEDEEERNVFKFICDASSLHQVRKKLDSLGLCSVSCALEFIPNSKVQLAEPDLEQAAHLI
QALSNHEDVIHVYDNIE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057444
RefSeq Size 1479
RefSeq ORF 891
Synonyms CCDC44; MC4DN8
Locus ID 51204
UniProt ID Q9BSH4
Cytogenetics 17q23.3
Summary This gene encodes a mitochondrial protein that function as a translational activator of mitochondrially-encoded cytochrome c oxidase 1. Mutations in this gene are associated with Leigh syndrome.[provided by RefSeq, Mar 2010]
Write Your Own Review
You're reviewing:TACO1 (NM_016360) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402545 TACO1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402545 Transient overexpression lysate of translational activator of mitochondrially encoded cytochrome c oxidase I (TACO1), nuclear gene encoding mitochondrial protein 100 ug
$436.00
TP302948 Recombinant protein of human coiled-coil domain containing 44 (CCDC44), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.