AP2S1 (NM_004069) Human Mass Spec Standard

SKU PH302919

AP2S1 MS Standard C13 and N15-labeled recombinant protein (NP_004060)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC202919]
• Predicted MW: 17 kDa
• Protein Sequence:
  Protein Sequence

  >RC202919 protein sequence; Red=Cloning site Green=Tags(s); ; MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCIC; VDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQS; LE; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_004060
• RefSeq Size: 965
• RefSeq ORF: 426
• Synonyms: AP17; CLAPS2; FBH3; FBHOk; HHC3
• Locus ID: 1175
• UniProt ID: P53680
• Cytogenetics: 19q13.32
• Summary: One of two major clathrin-associated adaptor complexes, AP-2, is a heterotetramer which is associated with the plasma membrane. This complex is composed of two large chains, a medium chain, and a small chain. This gene encodes the small chain of this complex. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]
• Protein Pathways: Endocytosis, Huntington's disease