OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

STMN2 (NM_007029) Human Mass Spec Standard

Be the first to review this product
SKU
PH302914
STMN2 MS Standard C13 and N15-labeled recombinant protein (NP_008960)
Size:
10 ug
  $3,360.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA322450 Rabbit Polyclonal Anti-STMN2/STMN3/STMN4 Antibody
100 ul
$305.00
LY416248 Transient overexpression lysate of stathmin-like 2 (STMN2) (as WB positive control) 100 ug
$436.00

Other products for "STMN2 or NM_007029"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202914
Predicted MW 20.8 kDa
Protein Sequence
Protein Sequence
>RC202914 protein sequence
Red=Cloning site Green=Tags(s)

MAKTAMAYKEKMKELSMLSLICSCFYPEPRNINIYTYDDMEVKQINKRASGQAFELILKPPSPISEAPRT
LASPKKKDLSLEEIQKKLEAAEERRKSQEAQVLKQLAEKREHEREVLQKALEENNNFSKMAEEKLILKME
QIKENREANLAAIIERLQEKERHAAEVRRNKELQVELSG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_008960
RefSeq Size 2232
RefSeq ORF 537
Synonyms SCG10; SCGN10
Locus ID 11075
UniProt ID Q93045
Cytogenetics 8q21.13
Summary This gene encodes a member of the stathmin family of phosphoproteins. Stathmin proteins function in microtubule dynamics and signal transduction. The encoded protein plays a regulatory role in neuronal growth and is also thought to be involved in osteogenesis. Reductions in the expression of this gene have been associated with Down's syndrome and Alzheimer's disease. Alternatively spliced transcript variants have been observed for this gene. A pseudogene of this gene is located on the long arm of chromosome 6. provided by RefSeq, Nov 2010
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "STMN2" proteins (3)
SKU Description Size Price
LC416248 Lyophilized STMN2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416248 Transient overexpression lysate of stathmin-like 2 (STMN2) (as WB positive control) 100 ug
$436.00
TP302914 Recombinant protein of human stathmin-like 2 (STMN2), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products