JM4 (PRAF2) (NM_007213) Human Mass Spec Standard

SKU
PH302910
PRAF2 MS Standard C13 and N15-labeled recombinant protein (NP_009144)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202910]
Predicted MW 19.3 kDa
Protein Sequence
Protein Sequence
>RC202910 protein sequence
Red=Cloning site Green=Tags(s)

MSEVRLPPLRALDDFVLGSARLAAPDPCDPQRWCHRVINNLLYYQTNYLLCFGIGLALAGYVRPLHTLLS
ALVVAVALGVLVWAAETRAAVRRCRRSHPAACLAAVLAVGLLVLWVAGGACTFLFSIAGPVLLILVHASL
RLRNLKNKIENKIESIGLKRTPMGLLLEALGQEQEAGS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_009144
RefSeq Size 1316
RefSeq ORF 534
Synonyms JM4; Yip6a
Locus ID 11230
UniProt ID O60831
Cytogenetics Xp11.23
Summary May be involved in ER/Golgi transport and vesicular traffic. Plays a proapoptotic role in cerulenin-induced neuroblastoma apoptosis.[UniProtKB/Swiss-Prot Function]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:JM4 (PRAF2) (NM_007213) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402110 PRAF2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402110 Transient overexpression lysate of PRA1 domain family, member 2 (PRAF2) 100 ug
$436.00
TP302910 Recombinant protein of human PRA1 domain family, member 2 (PRAF2), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.