PEX14 (NM_004565) Human Mass Spec Standard

SKU
PH302903
PEX14 MS Standard C13 and N15-labeled recombinant protein (NP_004556)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202903]
Predicted MW 41.2 kDa
Protein Sequence
Protein Sequence
>RC202903 protein sequence
Red=Cloning site Green=Tags(s)

MASSEQAEQPSQPSSTPGSENVLPREPLIATAVKFLQNSRVRQSPLATRRAFLKKKGLTDEEIDMAFQQS
GTAADEPSSLGPATQVVPVQPPHLISQPYSPAGSRWRDYGALAIIMAGIAFGFHQLYKKYLLPLILGGRE
DRKQLERMEAGLSELSGSVAQTVTQLQTTLASVQELLIQQQQKIQELAHELAAAKATTSTNWILESQNIN
ELKSEINSLKGLLLNRRQFPPSPSAPKIPSWQIPVKSPSPSSPAAVNHHSSSDISPVSNESTSSSPGKEG
HSPEGSTVTYHLLGPQEEGEGVVDVKGQVRMEVQGEEEKREDKEDEEDEEDDDVSHVDEEDCLGVQREDR
RGGDGQINEQVEKLRRPEGASNESERD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004556
RefSeq Size 1945
RefSeq ORF 1131
Synonyms dJ734G22.2; NAPP2; PBD13A; Pex14p
Locus ID 5195
UniProt ID O75381
Cytogenetics 1p36.22
Summary This gene encodes an essential component of the peroxisomal import machinery. The protein is integrated into peroxisome membranes with its C-terminus exposed to the cytosol, and interacts with the cytosolic receptor for proteins containing a PTS1 peroxisomal targeting signal. The protein also functions as a transcriptional corepressor and interacts with a histone deacetylase. A mutation in this gene results in one form of Zellweger syndrome. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:PEX14 (NM_004565) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC417901 PEX14 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417901 Transient overexpression lysate of peroxisomal biogenesis factor 14 (PEX14) 100 ug
$436.00
TP302903 Recombinant protein of human peroxisomal biogenesis factor 14 (PEX14), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.