Dematin (DMTN) (NM_001978) Human Mass Spec Standard

SKU
PH302895
EPB49 MS Standard C13 and N15-labeled recombinant protein (NP_001969)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202895]
Predicted MW 45.5 kDa
Protein Sequence
Protein Sequence
>RC202895 protein sequence
Red=Cloning site Green=Tags(s)

MERLQKQPLTSPGSVSPSRDSSVPGSPSSIVAKMDNQVLGYKDLAAIPKDKAILDIERPDLMIYEPHFTY
SLLEHVELPRSRERSLSPKSTSPPPSPEVWADSRSPGIISQASAPRTTGTPRTSLPHFHHPETSRPDSNI
YKKPPIYKQRESVGGSPQTKHLIEDLIIESSKFPAAQPPDPNQPAKIETDYWPCPPSLAVVETEWRKRKA
SRRGAEEEEEEEDDDSGEEMKALRERQREELSKVTSNLGKMILKEEMEKSLPIRRKTRSLPDRTPFHTSL
HQGTSKSSSLPAYGRTTLSRLQSTEFSPSGSETGSPGLQNGEGQRGRMDRGNSLPCVLEQKIYPYEMLVV
TNKGRTKLPPGVDRMRLERHLSAEDFSRVFAMSPEEFGKLALWKRNELKKKASLF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001969
RefSeq Size 2825
RefSeq ORF 1215
Synonyms DMT; EPB49
Locus ID 2039
UniProt ID Q08495
Cytogenetics 8p21.3
Summary The protein encoded by this gene is an actin binding and bundling protein that plays a structural role in erythrocytes, by stabilizing and attaching the spectrin/actin cytoskeleton to the erythrocyte membrane in a phosphorylation-dependent manner. This protein contains a core domain in the N-terminus, and a headpiece domain in the C-terminus that binds F-actin. When purified from erythrocytes, this protein exists as a trimer composed of two 48 kDa polypeptides and a 52 kDa polypeptide. The different subunits arise from alternative splicing in the 3' coding region, where the headpiece domain is located. Disruption of this gene has been correlated with the autosomal dominant Marie Unna hereditary hypotrichosis disease, while loss of heterozygosity of this gene is thought to play a role in prostate cancer progression. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Nov 2014]
Write Your Own Review
You're reviewing:Dematin (DMTN) (NM_001978) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH325631 EPB49 MS Standard C13 and N15-labeled recombinant protein (NP_001107608) 10 ug
$3,255.00
PH325632 EPB49 MS Standard C13 and N15-labeled recombinant protein (NP_001107607) 10 ug
$3,255.00
LC419611 DMTN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426463 DMTN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426464 DMTN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426467 DMTN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419611 Transient overexpression lysate of erythrocyte membrane protein band 4.9 (dematin) (EPB49), transcript variant 1 100 ug
$436.00
LY426463 Transient overexpression lysate of erythrocyte membrane protein band 4.9 (dematin) (EPB49), transcript variant 2 100 ug
$436.00
LY426464 Transient overexpression lysate of erythrocyte membrane protein band 4.9 (dematin) (EPB49), transcript variant 3 100 ug
$436.00
LY426467 Transient overexpression lysate of erythrocyte membrane protein band 4.9 (dematin) (EPB49), transcript variant 6 100 ug
$436.00
TP302895 Recombinant protein of human erythrocyte membrane protein band 4.9 (dematin) (EPB49), transcript variant 1, 20 µg 20 ug
$737.00
TP325631 Recombinant protein of human erythrocyte membrane protein band 4.9 (dematin) (EPB49), transcript variant 3, 20 µg 20 ug
$737.00
TP325632 Recombinant protein of human erythrocyte membrane protein band 4.9 (dematin) (EPB49), transcript variant 2, 20 µg 20 ug
$737.00
TP710364 Purified recombinant protein of Human erythrocyte membrane protein band 4.9 (dematin) (EPB49), transcript variant 1, full length, with with C-terminal DDK tag, expressed in sf9, 20ug 20 ug
$515.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.