FOXO3 (NM_201559) Human Mass Spec Standard

SKU
PH302894
FOXO3 MS Standard C13 and N15-labeled recombinant protein (NP_963853)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202894]
Predicted MW 71.1 kDa
Protein Sequence
Protein Sequence
>RC202894 representing NM_201559
Red=Cloning site Green=Tags(s)

MAEAPASPAPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQASPAKPSGETAADSMIPEEEDDEDDEDGG
GRAGSAMAIGGGGGSGTLGSGLLLEDSARVLAPGGQDPGSGPATAAGGLSGGTQALLQPQQPLPPPQPGA
AGGSGQPRKCSSRRNAWGNLSYADLITRAIESSPDKRLTLSQIYEWMVRCVPYFKDKGDSNSSAGWKNSI
RHNLSLHSRFMRVQNEGTGKSSWWIINPDGGKSGKAPRRRAVSMDNSNKYTKSRGRAAKKKAALQTAPES
ADDSPSQLSKWPGSPTSRSSDELDAWTDFRSRTNSNASTVSGRLSPIMASTELDEVQDDDAPLSPMLYSS
SASLSPSVSKPCTVELPRLTDMAGTMNLNDGLTENLMDDLLDNITLPPSQPSPTGGLMQRSSSFPYTTKG
SGLGSPTSSFNSTVFGPSSLNSLRQSPMQTIQENKPATFSSMSHYGNQTLQDLLTSDSLSHSDVMMTQSD
PLMSQASTAVSAQNSRRNVMLRNDPMMSFAAQPNQGSLVNQNLLHHQHQTQGALGGSRALSNSVSNMGLS
ESSSLGSAKHQQQSPVSQSMQTLSDSLSGSSLYSTSANLPVMGHEKFPSDLDLDMFNGSLECDMESIIRS
ELMDADGLDFNFDSLISTQNVVGLNVGNFTGAKQASSQSWVPG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_963853
RefSeq Size 3311
RefSeq ORF 2019
Synonyms AF6q21; FKHRL1; FKHRL1P2; FOXO2; FOXO3A
Locus ID 2309
UniProt ID O43524
Cytogenetics 6q21
Summary This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. This gene likely functions as a trigger for apoptosis through expression of genes necessary for cell death. Translocation of this gene with the MLL gene is associated with secondary acute leukemia. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Chemokine signaling pathway, Endometrial cancer, Neurotrophin signaling pathway, Non-small cell lung cancer
Write Your Own Review
You're reviewing:FOXO3 (NM_201559) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH309846 FOXO3 MS Standard C13 and N15-labeled recombinant protein (NP_001446) 10 ug
$3,255.00
LC400566 FOXO3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC404461 FOXO3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400566 Transient overexpression lysate of forkhead box O3 (FOXO3), transcript variant 1 100 ug
$436.00
LY404461 Transient overexpression lysate of forkhead box O3 (FOXO3), transcript variant 2 100 ug
$436.00
TP302894 Recombinant protein of human forkhead box O3 (FOXO3), transcript variant 2, 20 µg 20 ug
$737.00
TP309846 Recombinant protein of human forkhead box O3 (FOXO3), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.