PCBD1 (NM_000281) Human Mass Spec Standard

SKU PH302880

PCBD1 MS Standard C13 and N15-labeled recombinant protein (NP_000272)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC202880]
• Predicted MW: 12 kDa
• Protein Sequence:
  Protein Sequence

  >RC202880 protein sequence; Red=Cloning site Green=Tags(s); ; MAGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVY; NKVHITLSTHECAGLSERDINLASFIEQVAVSMT; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_000272
• RefSeq Size: 1019
• RefSeq ORF: 312
• Synonyms: DCOH; PCBD; PCD; PHS
• Locus ID: 5092
• UniProt ID: P61457
• Cytogenetics: 10q22.1
• Summary: This gene encodes a member of the pterin-4-alpha-carbinolamine dehydratase family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. The encoded protein functions as both a dehydratase involved in tetrahydrobiopterin biosynthesis, and as a cofactor for HNF1A-dependent transcription. A deficiency of this enzyme leads to hyperphenylalaninemia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]
• Protein Families: Druggable Genome