OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NMT2 (NM_004808) Human Mass Spec Standard

Be the first to review this product
SKU
PH302876
NMT2 MS Standard C13 and N15-labeled recombinant protein (NP_004799)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA504158 NMT2 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3) 100 ul
$447.00
LY417742 Transient overexpression lysate of N-myristoyltransferase 2 (NMT2) (as WB positive control) 100 ug
$436.00

Other products for "NMT2 or NM_004808"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202876
Predicted MW 57 kDa
Protein Sequence
Protein Sequence
>RC202876 protein sequence
Red=Cloning site Green=Tags(s)

MAEDSESAASQQSLELDDQDTCGIDGDNEEETEHAKGSPGGYLGAKKKKKKQKRKKEKPNSGGTKSDSAS
DSQEIKIQQPSKNPSVPMQKLQDIQRAMELLSACQGPARNIDEAAKHRYQFWDTQPVPKLDEVITSHGAI
EPDKDNVRQEPYSLPQGFMWDTLDLSDAEVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPPGWLL
QWHCGVRVSSNKKLVGFISAIPANIRIYDSVKKMVEINFLCVHKKLRSKRVAPVLIREITRRVNLEGIFQ
AVYTAGVVLPKPIATCRYWHRSLNPKKLVEVKFSHLSRNMTLQRTMKLYRLPDVTKTSGLRPMEPKDIKS
VRELINTYLKQFHLAPVMDEEEVAHWFLPREHIIDTFVVESPNGKLTDFLSFYTLPSTVMHHPAHKSLKA
AYSFYNIHTETPLLDLMSDALILAKSKGFDVFNALDLMENKTFLEKLKFGIGDGNLQYYLYNWRCPGTDS
EKVGLVLQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004799
RefSeq Size 5004
RefSeq ORF 1494
Locus ID 9397
UniProt ID O60551
Cytogenetics 10p13
Summary This gene encodes one of two N-myristoyltransferase proteins. N-terminal myristoylation is a lipid modification that is involved in regulating the function and localization of signaling proteins. The encoded protein catalyzes the addition of a myristoyl group to the N-terminal glycine residue of many signaling proteins, including the human immunodeficiency virus type 1 (HIV-1) proteins, Gag and Nef. Alternative splicing results in multiple transcript variants. provided by RefSeq, Apr 2015
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NMT2" proteins (3)
SKU Description Size Price
LC417742 Lyophilized NMT2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417742 Transient overexpression lysate of N-myristoyltransferase 2 (NMT2) (as WB positive control) 100 ug
$436.00
TP302876 Recombinant protein of human N-myristoyltransferase 2 (NMT2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products