PMVK (NM_006556) Human Mass Spec Standard

SKU
PH302867
PMVK MS Standard C13 and N15-labeled recombinant protein (NP_006547)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202867]
Predicted MW 22 kDa
Protein Sequence
Protein Sequence
>RC202867 protein sequence
Red=Cloning site Green=Tags(s)

MAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQYAQEHGLNFQRLLDTSTYKE
AFRKDMIRWGEEKRQADPGFFCRKIVEGISQPIWLVSDTRRVSDIQWFREAYGAVTQTVRVVALEQSRQQ
RGWVFTPGVDDAESECGLDNFGDFDWVIENHGVEQRLEEQLENLIEFIRSRL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006547
RefSeq Size 1307
RefSeq ORF 576
Synonyms HUMPMKI; PMK; PMKA; PMKASE; POROK1
Locus ID 10654
UniProt ID Q15126
Cytogenetics 1q21.3
Summary This gene encodes a peroxisomal enzyme that is a member of the galactokinase, homoserine kinase, mevalonate kinase, and phosphomevalonate kinase (GHMP) family of ATP-dependent enzymes. The encoded protein catalyzes the conversion of mevalonate 5-phosphate to mevalonate 5-diphosphate, which is the fifth step in the mevalonate pathway of isoprenoid biosynthesis. Mutations in this gene are linked to certain types of porokeratosis including disseminated superficial porokeratosis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2017]
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Terpenoid backbone biosynthesis
Write Your Own Review
You're reviewing:PMVK (NM_006556) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416571 PMVK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416571 Transient overexpression lysate of phosphomevalonate kinase (PMVK) 100 ug
$436.00
TP302867 Recombinant protein of human phosphomevalonate kinase (PMVK), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720221 Recombinant protein of human phosphomevalonate kinase (PMVK) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.