THG1L (NM_017872) Human Mass Spec Standard

SKU
PH302845
THG1L MS Standard C13 and N15-labeled recombinant protein (NP_060342)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202845]
Predicted MW 34.8 kDa
Protein Sequence
Protein Sequence
>RC202845 protein sequence
Red=Cloning site Green=Tags(s)

MWGACKVKVHDSLATISITLRRYLRLGATMAKSKFEYVRDFEADDTCLAHCWVVVRLDGRNFHRFAEKHN
FAKPNDSRALQLMTKCAQTVMEELEDIVIAYGQSDEYSFVFKRKTNWFKRRASKFMTHVASQFASSYVFY
WRDYFEDQPLLYPPGFDGRVVVYPSNQTLKDYLSWRQADCHINNLYNTVFWALIQQSGLTPVQAQGRLQG
TLAADKNEILFSEFNINYNNEPPMYRKGTVLIWQKVDEVMTKEIKLPTEMEGKKMAVTRTRTKPVPLHCD
IIGDAFWKEHPEILDEDS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060342
RefSeq Size 1320
RefSeq ORF 894
Synonyms hTHG1; ICF45; IHG-1; IHG1; SCAR28; THG1
Locus ID 54974
UniProt ID Q9NWX6
Cytogenetics 5q33.3
Summary The protein encoded by this gene is a mitochondrial protein that is induced by high levels of glucose and is associated with diabetic nephropathy. The encoded protein appears to increase mitochondrial biogenesis, which could lead to renal fibrosis. Another function of this protein is that of a guanyltransferase, adding GMP to the 5' end of tRNA(His). Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2015]
Write Your Own Review
You're reviewing:THG1L (NM_017872) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC413494 THG1L HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413494 Transient overexpression lysate of tRNA-histidine guanylyltransferase 1-like (S. cerevisiae) (THG1L) 100 ug
$436.00
TP302845 Recombinant protein of human tRNA-histidine guanylyltransferase 1-like (S. cerevisiae) (THG1L), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.