OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

THG1L (NM_017872) Human Mass Spec Standard

Be the first to review this product
SKU
PH302845
THG1L MS Standard C13 and N15-labeled recombinant protein (NP_060342)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY413494 Transient overexpression lysate of tRNA-histidine guanylyltransferase 1-like (S. cerevisiae) (THG1L) (as WB positive control) 100 ug
$436.00

Other products for "THG1L or NM_017872"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202845
Predicted MW 34.8 kDa
Protein Sequence
Protein Sequence
>RC202845 protein sequence
Red=Cloning site Green=Tags(s)

MWGACKVKVHDSLATISITLRRYLRLGATMAKSKFEYVRDFEADDTCLAHCWVVVRLDGRNFHRFAEKHN
FAKPNDSRALQLMTKCAQTVMEELEDIVIAYGQSDEYSFVFKRKTNWFKRRASKFMTHVASQFASSYVFY
WRDYFEDQPLLYPPGFDGRVVVYPSNQTLKDYLSWRQADCHINNLYNTVFWALIQQSGLTPVQAQGRLQG
TLAADKNEILFSEFNINYNNEPPMYRKGTVLIWQKVDEVMTKEIKLPTEMEGKKMAVTRTRTKPVPLHCD
IIGDAFWKEHPEILDEDS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060342
RefSeq Size 1320
RefSeq ORF 894
Synonyms hTHG1; ICF45; IHG-1; IHG1; SCAR28; THG1
Locus ID 54974
UniProt ID Q9NWX6
Cytogenetics 5q33.3
Summary The protein encoded by this gene is a mitochondrial protein that is induced by high levels of glucose and is associated with diabetic nephropathy. The encoded protein appears to increase mitochondrial biogenesis, which could lead to renal fibrosis. Another function of this protein is that of a guanyltransferase, adding GMP to the 5' end of tRNA(His). Several transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Dec 2015
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "THG1L" proteins (3)
SKU Description Size Price
LC413494 Lyophilized THG1L HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413494 Transient overexpression lysate of tRNA-histidine guanylyltransferase 1-like (S. cerevisiae) (THG1L) (as WB positive control) 100 ug
$436.00
TP302845 Recombinant protein of human tRNA-histidine guanylyltransferase 1-like (S. cerevisiae) (THG1L), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products