OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PLCXD1 (NM_018390) Human Mass Spec Standard

Be the first to review this product
SKU
PH302835
PLCXD1 MS Standard C13 and N15-labeled recombinant protein (NP_060860)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA808765 PLCXD1 mouse monoclonal antibody, clone OTI2D7 (formerly 2D7) 100 ul
$447.00
LY413089 Transient overexpression lysate of phosphatidylinositol-specific phospholipase C, X domain containing 1 (PLCXD1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "PLCXD1 or NM_018390"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202835
Predicted MW 36.7 kDa
Protein Sequence
Protein Sequence
>RC202835 protein sequence
Red=Cloning site Green=Tags(s)

MGGQVSASNSFSRLHCRNANEDWMSALCPRLWDVPLHHLSIPGSHDTMTYCLNKKSPISHEESRLLQLLN
KALPCITRPVVLKWSVTQALDVTEQLDAGVRYLDLRIAHMLEGSEKNLHFVHMVYTTALVEDTLTEISEW
LERHPREVVILACRNFEGLSEDLHEYLVACIKNIFGDMLCPRGEVPTLRQLWSRGQQVIVSYEDESSLRR
HHELWPGVPYWWGNRVKTEALIRYLETMKSCGRPGGLFVAGINLTENLQYVLAHPSESLEKMTLPNLPRL
SAWVREQCPGPGSRCTNIIAGDFIGADGFVSDVIALNQKLLWC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060860
RefSeq Size 5320
RefSeq ORF 969
Synonyms LL0XNC01-136G2.1
Locus ID 55344
UniProt ID Q9NUJ7
Cytogenetics X;Y
Summary This gene is the most terminal protein-coding gene in the pseudoautosomal (PAR) region on chromosomes X and Y. Alternate splicing results in multiple transcript variants. provided by RefSeq, Mar 2010
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PLCXD1" proteins (3)
SKU Description Size Price
LC413089 Lyophilized PLCXD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413089 Transient overexpression lysate of phosphatidylinositol-specific phospholipase C, X domain containing 1 (PLCXD1), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP302835 Recombinant protein of human phosphatidylinositol-specific phospholipase C, X domain containing 1 (PLCXD1), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products