PLCXD1 (NM_018390) Human Mass Spec Standard

SKU
PH302835
PLCXD1 MS Standard C13 and N15-labeled recombinant protein (NP_060860)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202835]
Predicted MW 36.7 kDa
Protein Sequence
Protein Sequence
>RC202835 protein sequence
Red=Cloning site Green=Tags(s)

MGGQVSASNSFSRLHCRNANEDWMSALCPRLWDVPLHHLSIPGSHDTMTYCLNKKSPISHEESRLLQLLN
KALPCITRPVVLKWSVTQALDVTEQLDAGVRYLDLRIAHMLEGSEKNLHFVHMVYTTALVEDTLTEISEW
LERHPREVVILACRNFEGLSEDLHEYLVACIKNIFGDMLCPRGEVPTLRQLWSRGQQVIVSYEDESSLRR
HHELWPGVPYWWGNRVKTEALIRYLETMKSCGRPGGLFVAGINLTENLQYVLAHPSESLEKMTLPNLPRL
SAWVREQCPGPGSRCTNIIAGDFIGADGFVSDVIALNQKLLWC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060860
RefSeq Size 5320
RefSeq ORF 969
Synonyms LL0XNC01-136G2.1
Locus ID 55344
UniProt ID Q9NUJ7
Cytogenetics X;Y
Summary This gene is the most terminal protein-coding gene in the pseudoautosomal (PAR) region on chromosomes X and Y. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010]
Write Your Own Review
You're reviewing:PLCXD1 (NM_018390) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC413089 PLCXD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413089 Transient overexpression lysate of phosphatidylinositol-specific phospholipase C, X domain containing 1 (PLCXD1), transcript variant 1 100 ug
$436.00
TP302835 Recombinant protein of human phosphatidylinositol-specific phospholipase C, X domain containing 1 (PLCXD1), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.