UBC6e (UBE2J1) (NM_016021) Human Mass Spec Standard

SKU PH302826

UBE2J1 MS Standard C13 and N15-labeled recombinant protein (NP_057105)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC202826]
• Predicted MW: 35 kDa
• Protein Sequence:
  Protein Sequence

  >RC202826 representing NM_016021; Red=Cloning site Green=Tags(s); ; METRYNLKSPAVKRLMKEAAELKDPTDHYHAQPLEDNLFEWHFTVRGPPDSDFDGGVYHGRIVLPPEYPM; KPPSIILLTANGRFEVGKKICLSISGHHPETWQPSWSIRTALLAIIGFMPTKGEGAIGSLDYTPEERRAL; AKKSQDFCCEGCGSAMKDVLLPLKSGSDSSQADQEAKELARQISFKAEVNSSGKTISESDLNHSFSLTDL; QDDIPTTFQGATASTSYGVQNSSAASFHQPTQPVAKNTSMSPRQRRAQQQSQRRLSTSPDVIQGHQPRDN; HTDHGGSAVLIVILTLALAALIFRRIYLANEYIFDFEL; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_057105
• RefSeq Size: 4360
• RefSeq ORF: 954
• Synonyms: CGI-76; HSPC153; HSPC205; HSU93243; NCUBE-1; NCUBE1; UBC6; UBC6E; Ubc6p
• Locus ID: 51465
• UniProt ID: Q9Y385
• Cytogenetics: 6q15
• Summary: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is located in the membrane of the endoplasmic reticulum (ER) and may contribute to quality control ER-associated degradation by the ubiquitin-proteasome system. [provided by RefSeq, Jul 2008]
• Protein Families: Transmembrane
• Protein Pathways: Parkinson's disease, Ubiquitin mediated proteolysis